MMP20 Antibody - #DF7694
| Product: | MMP20 Antibody |
| Catalog: | DF7694 |
| Description: | Rabbit polyclonal antibody to MMP20 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 54 kDa; 54kD(Calculated). |
| Uniprot: | O60882 |
| RRID: | AB_2841165 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7694, RRID:AB_2841165.
Fold/Unfold
AI2A2; Enamel metalloproteinase; Enamelysin; Matrix metalloproteinase 20; Matrix metalloproteinase-20; MMP 20; MMP-20; MMP20; MMP20_HUMAN;
Immunogens
- O60882 MMP20_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O60882 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y48 | Phosphorylation | Uniprot | |
| Y49 | Phosphorylation | Uniprot | |
| K118 | Ubiquitination | Uniprot | |
| T123 | Phosphorylation | Uniprot | |
| Y124 | Phosphorylation | Uniprot | |
| S127 | Phosphorylation | Uniprot | |
| K128 | Acetylation | Uniprot | |
| Y129 | Phosphorylation | Uniprot | |
| K140 | Acetylation | Uniprot | |
| Y415 | Phosphorylation | Uniprot | |
| S416 | Phosphorylation | Uniprot | |
| Y417 | Phosphorylation | Uniprot | |
| T461 | Phosphorylation | Uniprot | |
| Y462 | Phosphorylation | Uniprot | |
| Y464 | Phosphorylation | Uniprot | |
| T466 | Phosphorylation | Uniprot |
Research Backgrounds
Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix: aggrecan and the cartilage oligomeric matrix protein (COMP). May play a central role in tooth enamel formation. Cleaves aggrecan at the '360-Asn-|-Phe-361' site.
Autoactivates at least at the 107-Asn-|-Tyr-108 site.
Secreted>Extracellular space>Extracellular matrix.
Expressed specifically in the enamel organ.
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
Belongs to the peptidase M10A family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.