Product: HE4 Antibody
Catalog: DF7703
Description: Rabbit polyclonal antibody to HE4
Application: WB
Cited expt.: WB
Reactivity: Human
Mol.Wt.: 23 kDa; 13kD(Calculated).
Uniprot: Q14508
RRID: AB_2841174

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
HE4 Antibody detects endogenous levels of total HE4.
RRID:
AB_2841174
Cite Format: Affinity Biosciences Cat# DF7703, RRID:AB_2841174.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

dJ461P17.6; EDDM4; epididymal protein 4; Epididymal secretory protein E4; Epididymis specific whey acidic protein type four disulfide core; HE 4; Major epididymis specific protein E4; Major epididymis-specific protein E4; MGC57529; Putative protease inhibitor WAP5; WAP 5; WAP domain containing protein HE4; WAP domain containing protein HE4 V4; WAP four disulfide core domain 2; WAP four disulfide core domain protein 2; WAP four-disulfide core domain protein 2; WAP5; WFDC 2; WFDC2; WFDC2_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human HE4, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q14508 WFDC2_HUMAN:

Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis.

Sequence:
MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Research Backgrounds

Function:

Broad range protease inhibitor.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis.

References

1). ZNF703 promotes tumor progression in ovarian cancer by interacting with HE4 and epigenetically regulating PEA15. JOURNAL OF EXPERIMENTAL & CLINICAL CANCER RESEARCH, 2020 (PubMed: 33246486) [IF=11.3]

Application: WB    Species: human    Sample: ovarian cancer cells

Fig. 4 ZNF703 interacted with HE4 and HE4 promoted the nuclear translocation of the ZNF703. a The co-immunoprecipitation analysis of ZNF703 and HE4 was performed in ovarian cancer cells (The left two were performed in CAOV3 cell line and the right two were performed in OVCAR3 cell line. The corresponding molecular weight was added to the right side).

Application: IF/ICC    Species: human    Sample: CAOV3 and OVCAR3 cells

Fig.4 The immunofluorescence co-localization of ZNF703 and HE4 was performed in CAOV3 and OVCAR3 cells (The green color was for ZNF703 and the red color was for HE4, DAPI was blue, the colocalization was yellow) (×800). The arrow indicated the co-localization in the nucleus.

Application: WB    Species: human    Sample: CAOV3 and OVCAR3 cells

Fig.4 e, f Western blot determined nuclear and cytoplasmic distribution of ZNF703 after nuclear cytoplasmic fractionation in CAOV3 and OVCAR3 cells transfected with the overexpressed HE4 plasmid or control.

Application: WB    Species: human    Sample: CAOV3 and OVCAR3 cells

Fig.4 e, f Western blot determined nuclear and cytoplasmic distribution of ZNF703 after nuclear cytoplasmic fractionation in CAOV3 and OVCAR3 cells transfected with the overexpressed HE4 plasmid or control.

Application: WB    Species: human    Sample: CAOV3 and OVCAR3 cells

Fig.4 g, h Nuclear and cytoplasmic distribution of ZNF703 tested by western blot after nuclear cytoplasmic fractionation in CAOV3 and OVCAR3 cells transfected with HE4 siRNA or control.

Application: WB    Species: human    Sample: CAOV3 and OVCAR3 cells

Fig.4 g, h Nuclear and cytoplasmic distribution of ZNF703 tested by western blot after nuclear cytoplasmic fractionation in CAOV3 and OVCAR3 cells transfected with HE4 siRNA or control.

2). Effect of human epididymis protein 4 on hyperoxia-induced bronchial dysplasia in newborn rats. Nucleosides, nucleotides & nucleic acids, 2025 (PubMed: 39004907) [IF=1.1]

3). Study on the mechanism of HE4 in hyperoxia-induced alveolar damage in rats. , 2022

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.