ILP2 Antibody - #DF7725
Product: | ILP2 Antibody |
Catalog: | DF7725 |
Description: | Rabbit polyclonal antibody to ILP2 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 33 kDa; 27kD(Calculated). |
Uniprot: | Q96P09 |
RRID: | AB_2841193 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7725, RRID:AB_2841193.
Fold/Unfold
Baculoviral IAP repeat containing 8; Baculoviral IAP repeat containing protein 8; Baculoviral IAP repeat-containing protein 8; BIRC 8; BIRC8; BIRC8 protein; BIRC8_HUMAN; hILP 2; hILP2; IAP like protein 2; IAP-like protein 2; ILP 2; ILP-2; Inhibitor of apoptosis like protein 2; Inhibitor of apoptosis-like protein 2; Testis specific inhibitor of apoptosis; Testis-specific inhibitor of apoptosis;
Immunogens
A synthesized peptide derived from human ILP2, corresponding to a region within N-terminal amino acids.
- Q96P09 BIRC8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS
Research Backgrounds
Protects against apoptosis mediated by BAX.
Cytoplasm.
Testis specific in normal tissues.
Belongs to the IAP family.
Research Fields
· Cellular Processes > Cell growth and death > Apoptosis - multiple species. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Small cell lung cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.