OAS1 Antibody - #DF7760
Product: | OAS1 Antibody |
Catalog: | DF7760 |
Description: | Rabbit polyclonal antibody to OAS1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 46 kDa; 46kD(Calculated). |
Uniprot: | P00973 |
RRID: | AB_2841226 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7760, RRID:AB_2841226.
Fold/Unfold
(2 5')oligo(A) synthetase 1; (2-5'')oligo(A) synthase 1; 2 5 Oligoadenylate Synthetase 1; 2 5' oligo A synthase 1; 2 5' oligo A synthetase 1; 2 5A synthase 1; 2 5A synthetase 1; 2' 5' oligo A synthetase 1; 2' 5' oligoadenylate synthetase 1 40/46kDa; 2' 5' oligoadenylate synthetase 1; 2' 5' oligoisoadenylate synthetase 1; 2''-5''-oligoadenylate synthase 1; 2'5' oligo A synthetase 1; 2'5' oligoadenylate synthetase 1; 2'5' oligoisoadenylate synthetase 1; 2-5A synthase 1; E18/E16; IFI 4; IFI4; OAS 1; OAS1; OAS1_HUMAN; OIAS; OIASI; p46/p42 OAS;
Immunogens
A synthesized peptide derived from human OAS1, corresponding to a region within C-terminal amino acids.
- P00973 OAS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
Research Backgrounds
Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.
Cytoplasm. Mitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Secreted.
Note: Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions.
Belongs to the 2-5A synthase family.
Research Fields
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.