Product: APBB1IP Antibody
Catalog: DF7836
Description: Rabbit polyclonal antibody to APBB1IP
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 100 kd(Observed); 73kD(Calculated).
Uniprot: Q7Z5R6
RRID: AB_2841276

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:1000-3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
APBB1IP Antibody detects endogenous levels of total APBB1IP.
RRID:
AB_2841276
Cite Format: Affinity Biosciences Cat# DF7836, RRID:AB_2841276.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AB1IP; Amyloid beta A4 precursor protein binding family B member 1 interacting protein; Amyloid beta precursor protein binding family B member 1; APBB1 interacting protein 1; INAG1; OTTHUMP00000019344; PREL 1; PREL1; Proline rich EVH1 ligand 1; Proline rich protein 73; Rap1 GTP interacting adapter molecule; RAP1 interacting adaptor molecule; RARP 1; RARP1; Retinoic acid responsive proline rich protein 1;

Immunogens

Immunogen:

A synthesized peptide derived from human APBB1IP, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q7Z5R6 AB1IP_HUMAN:

Widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes.

Sequence:
MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVVKVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENVVEVLSDWTRDTENKILFLEKEEKYAVFKNPQNFYLDNRGKKESKETNEKMNAKNKESLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGTQHKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDTRTLNQWVMGIRIAKYGKTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPALGNHHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHPGGAGGGEQDFMSDLMKALQKKRGNVS

Research Backgrounds

Function:

Appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. Suppresses insulin-induced promoter activities through AP1 and SRE. Mediates Rap1-induced adhesion.

Subcellular Location:

Cell membrane>Peripheral membrane protein. Cell projection>Lamellipodium. Cell junction>Focal adhesion. Cytoplasm>Cytoskeleton.
Note: Colocalizes with ENA/VASP proteins at lamellipodia tips and focal adhesions, and F-actin at the leading edge. At the membrane surface, associates, via the PH domain, preferentially with the inositol phosphates, PtdIns(5)P and PtdIns(3)P. This binding appears to be necessary for the efficient interaction of the RA domain to Ras-GTPases (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes.

Family&Domains:

The two Pro-rich regions are required for the suppression of AP1 transcription activity.

Belongs to the MRL family.

Research Fields

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Platelet activation.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.