Vitamin D Binding protein Antibody - #DF7840
Product: | Vitamin D Binding protein Antibody |
Catalog: | DF7840 |
Description: | Rabbit polyclonal antibody to Vitamin D Binding protein |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Bovine, Horse, Sheep |
Mol.Wt.: | 53kd; 53kD(Calculated). |
Uniprot: | P02774 |
RRID: | AB_2841279 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7840, RRID:AB_2841279.
Fold/Unfold
DBP; DBP/GC; GC; Gc globulin; Gc-globulin; GRD3; Group specific component; Group specific component vitamin D binding protein; Group-specific component; hDBP; VDB; VDBG; VDBP; Vitamin D binding alpha globulin; Vitamin D-binding protein; VTDB_HUMAN;
Immunogens
A synthesized peptide derived from human Vitamin D Binding protein, corresponding to a region within the internal amino acids.
- P02774 VTDB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.
Allele GC*1S is O-glycosylated at Thr-436. The trisaccharide sugar moiety can be modified by the successive removal of neuraminic acid and galactose leaving an O-mceeN-acetyl-galactosamine. This conversion is thought to produce a macrophage-activating factor (Gc-MAF). Only a minor proportion of plasma GC is O-glycosylated. The potential N-glycosylation site predicted at Asn-288 is thought to be nonglycosylated.
Secreted.
Expressed in the liver. Found in plasma, ascites, cerebrospinal fluid and urine.
Belongs to the ALB/AFP/VDB family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.