SAA4 Antibody - #DF7899
Product: | SAA4 Antibody |
Catalog: | DF7899 |
Description: | Rabbit polyclonal antibody to SAA4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 15 kDa; 15kD(Calculated). |
Uniprot: | P35542 |
RRID: | AB_2841317 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7899, RRID:AB_2841317.
Fold/Unfold
Amyloid A, serum, 4; C SAA; C-SAA; Constitutively expressed serum amyloid A protein; CSAA; SAA 4; Saa4; SAA4 protein; SAA4_HUMAN; Serum amyloid A 4 protein; Serum amyloid A-4 protein; Serum amyloid A4 constitutive;
Immunogens
A synthesized peptide derived from human SAA4, corresponding to a region within C-terminal amino acids.
- P35542 SAA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
Research Backgrounds
Major acute phase reactant. Apolipoprotein of the HDL complex.
Secreted.
Expressed by the liver; secreted in plasma.
Belongs to the SAA family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.