C17orf37 Antibody - #DF7920
| Product: | C17orf37 Antibody |
| Catalog: | DF7920 |
| Description: | Rabbit polyclonal antibody to C17orf37 |
| Application: | WB IHC |
| Cited expt.: | WB, IHC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 12 kDa; 12kD(Calculated). |
| Uniprot: | Q9BRT3 |
| RRID: | AB_2841334 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7920, RRID:AB_2841334.
Fold/Unfold
C17orf37; C17orf37 homolog; C35; chromosome 17 open reading frame 37; HBV X transactivated gene 4 protein; HBV X-transactivated gene 4 protein; HBV XAg transactivated protein 4; HBV XAg-transactivated protein 4; MGC14832; Mien1; MIEN1_HUMAN; Migration and invasion enhancer 1; ORB3; Protein C17orf37; Protein C35; RDX12; Redox protein, 12-KD; XTP4;
Immunogens
A synthesized peptide derived from human C17orf37, corresponding to a region within C-terminal amino acids.
Among normal tissues, present only in Leydig cells. Strongly up-regulated in breast cancers and in brain cancer distant metastasis (at protein level). Up-regulated in prostate cancer cells and in the higher grades of prostate adenocarcinoma (at protein level).
- Q9BRT3 MIEN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process.
Isoprenylation facilitates association with the plasma membrane and enhances the migratory phenotype of cells by inducing increased filopodia formation.
Cytoplasm>Cytosol. Cell membrane>Lipid-anchor>Cytoplasmic side.
Note: Concentrates at the leading edge of migrating cells. Localizes outside membrane raft regions.
Among normal tissues, present only in Leydig cells. Strongly up-regulated in breast cancers and in brain cancer distant metastasis (at protein level). Up-regulated in prostate cancer cells and in the higher grades of prostate adenocarcinoma (at protein level).
Belongs to the SelWTH family.
References
Application: WB Species: human Sample:
Application: IHC Species: human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.