FDX1 Antibody - #DF7950

Product: | FDX1 Antibody |
Catalog: | DF7950 |
Description: | Rabbit polyclonal antibody to FDX1 |
Application: | WB IF/ICC |
Cited expt.: | WB |
Reactivity: | Human |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 19 kDa; 19kD(Calculated). |
Uniprot: | P10109 |
RRID: | AB_2841351 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7950, RRID:AB_2841351.
Fold/Unfold
Adrenal ferredoxin; Adrenodoxin; Adrenodoxin, mitochondrial; ADX; ADX_HUMAN; FDX; fdx1; Ferredoxin 1; Ferredoxin-1; Hepatoredoxin; LOH11CR1D; Mitochondrial adrenodoxin; mitochondrial;
Immunogens
A synthesized peptide derived from human FDX1, corresponding to a region within the internal amino acids.
Highest levels in the adrenal gland (at protein level). Also detected in kidney and testis (at protein level).
- P10109 ADX_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons (By similarity).
Mitochondrion matrix.
Highest levels in the adrenal gland (at protein level). Also detected in kidney and testis (at protein level).
Belongs to the adrenodoxin/putidaredoxin family.
References
Application: WB Species: human Sample: Caki-1 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.