Product: beta Tubulin Antibody
Catalog: DF7967
Description: Rabbit polyclonal antibody to beta Tubulin
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 50 kDa; 50kD(Calculated).
Uniprot: P07437
RRID: AB_2841359

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
beta Tubulin Antibody detects endogenous levels of total beta Tubulin.
RRID:
AB_2841359
Cite Format: Affinity Biosciences Cat# DF7967, RRID:AB_2841359.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Tubulin beta 2b; Alpha tubulin; Alpha-tubulin ubiquitous; beta Ib tubulin; CDCBM5; CDCBM6; fd02b12; K ALPHA 1; M40; OK/SW-cl.56; TBA1B_HUMAN; TUBA1B; TUBB1; TUBB2; TUBB5; tubulin alpha 1b; Tubulin alpha-1B chain; Tubulin alpha-ubiquitous chain; Tubulin beta 1b; Tubulin beta 2A; tubulin beta 2A class IIa; Tubulin beta; tubulin beta chain; tubulin beta class I; tubulin beta-1 chain; tubulin beta-2A chain; tubulin beta-5 chain; Tubulin K-alpha-1; tubulin, alpha, ubiquitous; tubulin, beta 2A class IIa; tubulin, beta polypeptide 2; tubulin, beta polypeptide; tubulin, beta, class IIA; wu:fd02b12; zgc:55461;

Immunogens

Immunogen:

A synthesized peptide derived from human beta Tubulin, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P07437 TBB5_HUMAN:

Ubiquitously expressed with highest levels in spleen, thymus and immature brain.

Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

PTMs - P07437 As Substrate

Site PTM Type Enzyme
R2 Methylation
C12 S-Nitrosylation
K19 Acetylation
K19 Methylation
K19 Ubiquitination
S25 Phosphorylation
T33 Phosphorylation
T35 Phosphorylation
Y36 Phosphorylation
S40 Phosphorylation
R46 Methylation
S48 Phosphorylation
Y50 Phosphorylation
Y51 Phosphorylation
T55 Phosphorylation
K58 Acetylation
K58 Methylation
K58 Sumoylation
K58 Ubiquitination
Y59 Phosphorylation
T72 Phosphorylation
S75 Phosphorylation
S78 Phosphorylation
S95 Phosphorylation
K103 Acetylation
K103 Sumoylation
K103 Ubiquitination
Y106 Phosphorylation
T107 Phosphorylation
S115 Phosphorylation
K122 Ubiquitination
S126 Phosphorylation
T136 Phosphorylation
S138 Phosphorylation
T143 Phosphorylation
S145 Phosphorylation
T149 Phosphorylation
S153 Phosphorylation
K154 Ubiquitination
Y159 Phosphorylation
R162 Methylation
T166 Phosphorylation
S168 Phosphorylation
S172 Phosphorylation
K174 Ubiquitination
Y183 Phosphorylation
T196 Phosphorylation
T199 Phosphorylation
Y200 Phosphorylation
Y208 Phosphorylation
K216 Ubiquitination
T218 Phosphorylation
T219 Phosphorylation
T221 Phosphorylation
Y222 Phosphorylation
S234 Phosphorylation
C239 S-Nitrosylation
K252 Sumoylation
K252 Ubiquitination
T274 Phosphorylation
S275 Phosphorylation Q5TCY1 (TTBK1)
R276 Methylation
S278 Phosphorylation
Y281 Phosphorylation
T285 Phosphorylation
T290 Phosphorylation
K297 Ubiquitination
C303 S-Nitrosylation
Y310 Phosphorylation
T312 Phosphorylation
R318 Methylation
S322 Phosphorylation
K324 Acetylation
K324 Sumoylation
K324 Ubiquitination
K336 Acetylation
K336 Ubiquitination
S338 Phosphorylation
S339 Phosphorylation
Y340 Phosphorylation
K350 Sumoylation
K350 Ubiquitination
T351 Phosphorylation
K362 Ubiquitination
T366 Phosphorylation
S371 Phosphorylation
K379 Acetylation
K379 Ubiquitination
S382 Phosphorylation
T386 Phosphorylation
K392 Ubiquitination
T399 Phosphorylation
Y422 Phosphorylation
Y425 Phosphorylation
T429 Phosphorylation

Research Backgrounds

Function:

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

PTMs:

Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group. Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold.

Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella). Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of monoglycylation is still unclear (Probable).

Phosphorylated on Ser-172 by CDK1 during the cell cycle, from metaphase to telophase, but not in interphase. This phosphorylation inhibits tubulin incorporation into microtubules.

Subcellular Location:

Cytoplasm>Cytoskeleton.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed with highest levels in spleen, thymus and immature brain.

Subunit Structure:

Heterodimer of alpha and beta chains. A typical microtubule is a hollow water-filled tube with an outer diameter of 25 nm and an inner diameter of 15 nM. Alpha-beta heterodimers associate head-to-tail to form protofilaments running lengthwise along the microtubule wall with the beta-tubulin subunit facing the microtubule plus end conferring a structural polarity. Microtubules usually have 13 protofilaments but different protofilament numbers can be found in some organisms and specialized cells. Interacts with PIFO. Interacts with DIAPH1. Interacts with MX1 (By similarity). May interact with RNABP10 (By similarity). Interacts with CFAP157 (By similarity).

Family&Domains:

The highly acidic C-terminal region may bind cations such as calcium.

Belongs to the tubulin family.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.

References

1). Glypican-3-targeted macrophages delivering drug-loaded exosomes offer efficient cytotherapy in mouse models of solid tumours. Nature communications, 2024 (PubMed: 39313508) [IF=16.6]

2). Network Pharmacology and In Vitro Experimental Verification Reveal the Mechanism of the Hirudin in Suppressing Myocardial Hypertrophy. Frontiers in Pharmacology, 2022 (PubMed: 35784743) [IF=5.6]

Application: WB    Species: Rat    Sample: H9c2 cells

FIGURE 8 H9c2 cells were treated with 1 μM AngII, (0.6, 1.2 mM) hirudin and 10 μM losartan for 24 h, respectively. (A) The expression of STAT3, MAPK1 and IL-6 were analyzed by qRT-PCR, n = 6. (B) The IL-6 in cell supernatant was assayed by ELISA, n = 5. (C) Western blot for the expression of proteins including STAT3, p-STAT3, MAPK1, p-MAPK1 and IL-6. (D) Quantified by western blot analysis and normalized to control, n = 3. Bars represent the mean ± SD, *p < 0.05, **p < 0.01.

3). Facilitating microglia M2 polarization alleviates p-Synephrine-induced depressive-like behaviours in CSDS mice via the 5-HT6R-FYN-ERK1/2 pathway. International immunopharmacology, 2024 (PubMed: 39742728) [IF=5.6]

4). Buyang Huanwu Decoction improves synaptic plasticity of ischemic stroke by regulating the cAMP/PKA/CREB pathway. Journal of ethnopharmacology, 2024 (PubMed: 39089658) [IF=4.8]

5). Expression of Retinal G Protein-Coupled Receptor, a Member of the Opsin Family, in Human Skin Cells and Its Mediation of the Cellular Functions of Keratinocytes. Frontiers in Cell and Developmental Biology, 2022 (PubMed: 35445026) [IF=4.6]

6). Identification and Validation of Genes Related to Macrophage Polarization and Cell Death Modes Under Mycobacterium tuberculosis Infection. Journal of Inflammation Research, 2024 [IF=4.5]

Application: WB    Species: Human    Sample:

Figure 7 Macrophage polarization. (A) The flowchart of inducing THP-1 polarization into M1/M2 Mφ. Created with BioRender.com. (B) PCR validation of M1/M2 Mφ marker genes. Compare data between multiple groups using one way ANOVA. (C) WB validation of M1/M2 Mφ marker genes. Compare data between multiple groups using one way ANOVA. The statistical chart shows the analysis results of three independent repeated experiments.

7). Reduced endometrial expression of histone deacetylase 3 (HDAC3) in women with adenomyosis who complained of heavy menstrual bleeding. Reproductive BioMedicine Online, 2023 (PubMed: 37690341) [IF=3.7]

8). Reduced endometrial expression of histone deacetylase 3 in women with adenomyosis who complained of heavy menstrual bleeding. Reproductive biomedicine online, 2023 (PubMed: 37690341) [IF=3.7]

9). Roles of Rufy3 in experimental subarachnoid hemorrhage-induced early brain injury via accelerating neuronal axon repair and synaptic plasticity. Molecular Brain, 2022 (PubMed: 35461284) [IF=3.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.