Product: APOD Antibody
Catalog: DF7987
Description: Rabbit polyclonal antibody to APOD
Application: WB IF/ICC
Cited expt.: IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 30 kDa; 21kD(Calculated).
Uniprot: P05090
RRID: AB_2841371

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
APOD Antibody detects endogenous levels of total APOD.
RRID:
AB_2841371
Cite Format: Affinity Biosciences Cat# DF7987, RRID:AB_2841371.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

APO D; Apo-D; ApoD; APOD protein; APOD_HUMAN; Apolipoprotein D; ApolipoproteinD;

Immunogens

Immunogen:

A synthesized peptide derived from human APOD, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P05090 APOD_HUMAN:

Expressed in liver, intestine, pancreas, kidney, placenta, adrenal, spleen, fetal brain tissue and tears.

Sequence:
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

Research Backgrounds

Function:

APOD occurs in the macromolecular complex with lecithin-cholesterol acyltransferase. It is probably involved in the transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.

PTMs:

N-glycosylatd. N-glycan heterogeneity at Asn-65: Hex5HexNAc4 (major) and Hex6HexNAc5 (minor); at Asn-98: Hex5HexNAc4 (minor), dHex1Hex5HexNAc4 (major), dHex1Hex6HexNAc5 (minor) and dHex1Hex7HexNAc6 (minor).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in liver, intestine, pancreas, kidney, placenta, adrenal, spleen, fetal brain tissue and tears.

Family&Domains:

Belongs to the calycin superfamily. Lipocalin family.

References

1). Dual functions of microRNA-17 in maintaining cartilage homeostasis and protection against osteoarthritis. Nature Communications, 2022 (PubMed: 35508470) [IF=16.6]

Application: IF/ICC    Species: Mouse    Sample: articular cartilage

Fig. 5 scRNA-seq analysis identified three subsets of chondrocytes. a Medial femoral condyle tissue from the region enclosed by the dotted lines was isolated for cell dissociation. n = 9 mice. Scale bar, 250 μm. b Putative chondrocyte population (171 cells) and unsupervised clustering identified clusters C1, C2, and C3 in cartilage. c Heatmap showing the expression of the top 20 identified significantly differentially expressed genes in clusters C1, C2, and C3. d Immunofluorescence staining of representative markers identified by scRNA-seq in articular cartilage. n = 3 independent experiments. All scale bars, 100 μm. e GO analysis and representative genes for clusters C1, C2, and C3.

2). Identifying the signature of NAD+ metabolism-related genes for immunotherapy of gastric cancer. Heliyon, 2024 (PubMed: 39640811) [IF=4.0]

3). Proteomics Reveals the Key Molecules Involved in Curcumin-induced Protection Against Sciatic Nerve Injury in Rats. NEUROSCIENCE, 2022 (PubMed: 35870565) [IF=2.9]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.