ARFRP1 Antibody - #DF7990
| Product: | ARFRP1 Antibody |
| Catalog: | DF7990 |
| Description: | Rabbit polyclonal antibody to ARFRP1 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | Q13795 |
| RRID: | AB_2841374 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7990, RRID:AB_2841374.
Fold/Unfold
ADP ribosylation factor related protein 1; ADP-ribosylation factor-related protein 1; ARF related protein 1; ARF related protein; ARF-related protein 1; ARFRP_HUMAN; ARFRP1; ARL 18; ARL18; ARP 1; ARP; ARP1; Helicase like protein NHL; MGC6837; SCG10 like protein;
Immunogens
- Q13795 ARFRP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13795 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| K38 | Ubiquitination | Uniprot | |
| K112 | Ubiquitination | Uniprot | |
| S156 | Phosphorylation | Uniprot | |
| K157 | Ubiquitination | Uniprot | |
| T165 | Phosphorylation | Uniprot | |
| K174 | Ubiquitination | Uniprot |
Research Backgrounds
Trans-Golgi-associated GTPase that regulates protein sorting. Controls the targeting of ARL1 and its effector to the trans-Golgi. Required for the lipidation of chylomicrons in the intestine and required for VLDL lipidation in the liver.
Golgi apparatus. Golgi apparatus>trans-Golgi network.
Note: Located in the trans-Golgi in the GTP-bound active state.
Found in most tissues.
Interacts with SYS1.
Belongs to the small GTPase superfamily. Arf family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.