SOX10 Antibody - #DF8009

Product: | SOX10 Antibody |
Catalog: | DF8009 |
Description: | Rabbit polyclonal antibody to SOX10 |
Application: | WB |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 60 kDa; 50kD(Calculated). |
Uniprot: | P56693 |
RRID: | AB_2841386 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8009, RRID:AB_2841386.
Fold/Unfold
DOM; DOM; Dominant megacolon mouse human homolog of; MGC15649; PCWH; SOX 10; SOX10; SOX10_HUMAN; SRY (sex determining region Y) box 10; SRY (sex determining region Y) box 10; SRY box 10; SRY box containing gene 10; SRY related HMG box gene 10; SRY related HMG box gene 10; Transcription factor SOX 10; Transcription factor SOX-10; WS2E; WS4; WS4C;
Immunogens
A synthesized peptide derived from human SOX10, corresponding to a region within the internal amino acids.
- P56693 SOX10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Transcription factor that plays a central role in developing and mature glia. Specifically activates expression of myelin genes, during oligodendrocyte (OL) maturation, such as DUSP15 and MYRF, thereby playing a central role in oligodendrocyte maturation and CNS myelination. Once induced, MYRF cooperates with SOX10 to implement the myelination program. Transcriptional activator of MITF, acting synergistically with PAX3.
Cytoplasm. Nucleus. Mitochondrion outer membrane>Peripheral membrane protein>Cytoplasmic side.
Expressed in fetal brain and in adult brain, heart, small intestine and colon.
References
Application: WB Species: human Sample: TU177 and AMC‑HN‑8 cells
Application: WB Species: rat Sample: BMSCs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.