TNFRSF12A Antibody - #DF8023
| Product: | TNFRSF12A Antibody |
| Catalog: | DF8023 |
| Description: | Rabbit polyclonal antibody to TNFRSF12A |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 14 kDa; 14kD(Calculated). |
| Uniprot: | Q9NP84 |
| RRID: | AB_2841393 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8023, RRID:AB_2841393.
Fold/Unfold
CD 266; CD266; CD266 antigen; FGF inducible 14; FGF-inducible 14; Fibroblast growth factor inducible immediate early response protein 14; Fibroblast growth factor-inducible immediate-early response protein 14; FN 14; FN14; TNFRSF 12A; TNFRSF12A; TNR12_HUMAN; Tumor necrosis factor receptor superfamily member 12A; TWEAK R; Tweak receptor; Tweak-receptor; TweakR;
Immunogens
A synthesized peptide derived from human TNFRSF12A, corresponding to a region within the internal amino acids.
Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
- Q9NP84 TNR12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
Membrane>Single-pass type I membrane protein.
Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.