BCAM Antibody - #DF8041
| Product: | BCAM Antibody |
| Catalog: | DF8041 |
| Description: | Rabbit polyclonal antibody to BCAM |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 85 kDa; 67kD(Calculated). |
| Uniprot: | P50895 |
| RRID: | AB_2841403 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8041, RRID:AB_2841403.
Fold/Unfold
Antigen identified by monoclonal antibody F8; AU; Auberger B antigen; B CAM cell surface glycoprotein; B cell adhesion molecule; B-CAM cell surface glycoprotein; Basal cell adhesion molecule (Lu and Au blood groups); Basal cell adhesion molecule (Lutheran blood group); Basal cell adhesion molecule; Basal cell adhesion molecule Lu and Au blood groups; Basal cell adhesion molecule Lutheran blood group; Bcam; BCAM_HUMAN; CD239; CD239 antigen; F8/G253 antigen; Glycoprotein 95kDa; LU; Lutheran; Lutheran antigen; Lutheran blood group (Auberger b antigen included); Lutheran blood group Auberger b antigen included; Lutheran blood group glycoprotein; MSK19;
Immunogens
A synthesized peptide derived from human BCAM, corresponding to a region within C-terminal amino acids.
Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.
- P50895 BCAM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Laminin alpha-5 receptor. May mediate intracellular signaling.
Epinephrine-stimulated phosphorylation of Ser-621 by PKA enhances adhesion to laminin.
Membrane>Single-pass type I membrane protein.
Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.