TRIM29 Antibody - #DF8050

(1)   (7)  
Product: TRIM29 Antibody
Catalog: DF8050
Description: Rabbit polyclonal antibody to TRIM29
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 66 kDa; 66kD(Calculated).
Uniprot: Q14134
RRID: AB_2841408

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(90%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
TRIM29 Antibody detects endogenous levels of total TRIM29.
RRID:
AB_2841408
Cite Format: Affinity Biosciences Cat# DF8050, RRID:AB_2841408.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Ataxia telangiectasia group D associated protein; Ataxia telangiectasia group D-associated protein; ATDC; FLJ36085; TRI29_HUMAN; TRIM 29; TRIM29; Tripartite motif containing 29; Tripartite motif containing protein 29; Tripartite motif protein 29; Tripartite motif protein TRIM29; Tripartite motif-containing protein 29;

Immunogens

Immunogen:
Uniprot:

Q14134(TRI29_HUMAN) >>Visit HPA database.

Gene(ID):
TRIM29(23650)
Expression:
Q14134 TRI29_HUMAN:

Expressed in placenta, prostate and thymus.

Sequence:
MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Horse
90
Xenopus
70
Chicken
70
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q14134 As Substrate

Site PTM Type Enzyme
S7 Phosphorylation
S9 Phosphorylation
S12 Phosphorylation
S13 Phosphorylation
S21 Phosphorylation
S23 Phosphorylation
S26 Phosphorylation
S28 Phosphorylation
T33 Phosphorylation
K34 Acetylation
K38 Acetylation
K54 Ubiquitination
S58 Phosphorylation
K61 Ubiquitination
S67 Phosphorylation
S85 Phosphorylation
S91 Phosphorylation
Y93 Phosphorylation
S95 Phosphorylation
S98 Phosphorylation
K102 Acetylation
K102 Ubiquitination
S104 Phosphorylation
Y106 Phosphorylation
K115 Ubiquitination
K116 Acetylation
K116 Ubiquitination
K124 Ubiquitination
K129 Ubiquitination
S130 Phosphorylation
S133 Phosphorylation
K137 Ubiquitination
T139 Phosphorylation
S141 Phosphorylation
S152 Phosphorylation
T158 Phosphorylation
S164 Phosphorylation
K165 Ubiquitination
S166 Phosphorylation
S168 Phosphorylation
K180 Ubiquitination
K264 Ubiquitination
K275 Acetylation
K275 Ubiquitination
K281 Ubiquitination
K291 Acetylation
K291 Ubiquitination
K300 Acetylation
K300 Ubiquitination
S301 Phosphorylation
K307 Ubiquitination
K323 Ubiquitination
K325 Ubiquitination
K344 Ubiquitination
K361 Acetylation
K361 Ubiquitination
K429 Ubiquitination
Y454 Phosphorylation
T467 Phosphorylation
K469 Methylation
K469 Ubiquitination
Y471 Phosphorylation
S472 Phosphorylation
Y474 Phosphorylation
T476 Phosphorylation
K478 Acetylation
Y485 Phosphorylation
S488 Phosphorylation
S489 Phosphorylation
K495 Acetylation
K495 Ubiquitination
K500 Ubiquitination
Y506 Phosphorylation
T508 Phosphorylation
K509 Methylation
K509 Ubiquitination
S538 Phosphorylation
S540 Phosphorylation
Y544 Phosphorylation
S546 Phosphorylation
S550 Phosphorylation P49137 (MAPKAPK2)
S552 Phosphorylation P49137 (MAPKAPK2)
K554 Acetylation
K554 Ubiquitination
K561 Methylation
K561 Ubiquitination
K564 Ubiquitination
Y575 Phosphorylation

Research Backgrounds

Function:

Plays a crucial role in the regulation of macrophage activation in response to viral or bacterial infections within the respiratory tract. Mechanistically, TRIM29 interacts with IKBKG/NEMO in the lysosome where it induces its 'Lys-48' ubiquitination and subsequent degradation. In turn, the expression of type I interferons and the production of proinflammatory cytokines are inhibited. Additionally, induces the 'Lys-48' ubiquitination of STING1 in a similar way, leading to its degradation.

PTMs:

Constitutively phosphorylated by PKC on serine/threonine in A431 cells.

Subcellular Location:

Cytoplasm. Lysosome.
Note: Colocalizes with intermediate filaments.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in placenta, prostate and thymus.

Subunit Structure:

Interacts with VIM and HINT1. Interacts with IKBKG/NEMO. Interacts with STING1.

References

1). HCP5 prevents ubiquitination-mediated UTP3 degradation to inhibit apoptosis by activating c-Myc transcriptional activity. Molecular Therapy, 2022 (PubMed: 36245126) [IF=12.1]

Application: WB    Species: Human    Sample: KYSE150 and KYSE510 cells

Figure 4 HCP5 stabilizes UTP3 by blocking the interaction between UTP3 and TRIM29 (A) List of UTP3-interacting E3 ligases identified using MS analysis in KYSE150 and KYSE510 cells. (B) Western blot analyses of TRIM29 and UTP3 expression in control and TRIM29-silenced (shT29#1 and shT29#2) KYSE150 and KYSE510 cells. Representative results of at least three biological replicates are shown. (C) Western blot analyses of TRIM29 and UTP3 expression in 293T cells transfected with increasing amounts of TRIM29 (0.5, 1.0, and 2.0 μg). Representative results of at least three biological replicates are shown. (D) Confocal microscopy assessment of UTP3 and TRIM29 colocalization in the indicated cells. Nuclei were stained with Hoechst 33342. Scale bars, 30 μm. (E and F) Western blot analyses of TRIM29 and UTP3 distribution after coIP assays with the indicated cells (C, cytoplasm; N, nucleus). Representative results of at least three biological replicates are shown. (G and H) Western blot analyses to assess UTP3 ubiquitination in control and TRIM29-silenced KYSE150 (G) and KYSE510 (H) cells. Representative results of at least three biological replicates are shown. (I) Western blot analyses of TRIM29 and UTP3 in coIP assays performed with control and HCP5-silenced KYSE150 and KYSE510 cells. Representative results of at least three biological replicates are shown. (J and K) Confocal microscopy assessment of PLA spots (red) in the indicated cells. Each spot indicates a single interaction between UTP3 and TRIM29 proteins. Nuclei were stained with DAPI (blue). Scale bars, 10 μm. The data are presented as the means ± SD; two-tailed t test, ∗∗∗p < 0.001, ∗∗p < 0.01; n = 3. (L) Western blot analyses to assess UTP3 ubiquitination in the indicated cells. Representative results of at least three biological replicates are shown.

Application: IF/ICC    Species: Human    Sample: KYSE150 and KYSE510 cells

Figure 4 HCP5 stabilizes UTP3 by blocking the interaction between UTP3 and TRIM29 (A) List of UTP3-interacting E3 ligases identified using MS analysis in KYSE150 and KYSE510 cells. (B) Western blot analyses of TRIM29 and UTP3 expression in control and TRIM29-silenced (shT29#1 and shT29#2) KYSE150 and KYSE510 cells. Representative results of at least three biological replicates are shown. (C) Western blot analyses of TRIM29 and UTP3 expression in 293T cells transfected with increasing amounts of TRIM29 (0.5, 1.0, and 2.0 μg). Representative results of at least three biological replicates are shown. (D) Confocal microscopy assessment of UTP3 and TRIM29 colocalization in the indicated cells. Nuclei were stained with Hoechst 33342. Scale bars, 30 μm. (E and F) Western blot analyses of TRIM29 and UTP3 distribution after coIP assays with the indicated cells (C, cytoplasm; N, nucleus). Representative results of at least three biological replicates are shown. (G and H) Western blot analyses to assess UTP3 ubiquitination in control and TRIM29-silenced KYSE150 (G) and KYSE510 (H) cells. Representative results of at least three biological replicates are shown. (I) Western blot analyses of TRIM29 and UTP3 in coIP assays performed with control and HCP5-silenced KYSE150 and KYSE510 cells. Representative results of at least three biological replicates are shown. (J and K) Confocal microscopy assessment of PLA spots (red) in the indicated cells. Each spot indicates a single interaction between UTP3 and TRIM29 proteins. Nuclei were stained with DAPI (blue). Scale bars, 10 μm. The data are presented as the means ± SD; two-tailed t test, ∗∗∗p < 0.001, ∗∗p < 0.01; n = 3. (L) Western blot analyses to assess UTP3 ubiquitination in the indicated cells. Representative results of at least three biological replicates are shown.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.