PTP4A2 Antibody - #DF8076
| Product: | PTP4A2 Antibody |
| Catalog: | DF8076 |
| Description: | Rabbit polyclonal antibody to PTP4A2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 19 kDa; 19kD(Calculated). |
| Uniprot: | Q12974 |
| RRID: | AB_2841430 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8076, RRID:AB_2841430.
Fold/Unfold
BM 008; EC 3.1.3.48; HH 13; HH13; HH7 2; HU PP 1; HUPP 1; HUPP1; OV 1; OV1; phosphatase of regenerating liver 2; PRL 2; PRL2; Protein tyrosine phosphatase 4a2; protein tyrosine phosphatase IVA; protein tyrosine phosphatase IVA2; Protein tyrosine phosphatase of regenerating liver 2; protein tyrosine phosphatase type IVA 2; Protein tyrosine phosphatase type IVA member 2 isoform 1; protein tyrosine phosphatase type IVA, member 2; PTP (CAAXII); ptp IV1a; ptp IV1b; PTP4A; PTPCAAX2; TP4A2_HUMAN;
Immunogens
A synthesized peptide derived from human PTP4A2, corresponding to a region within the internal amino acids.
Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue.
- Q12974 TP4A2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB.
Farnesylated. Farnesylation is required for membrane targeting and for interaction with RABGGTB. Unfarnesylated forms are redirected to the nucleus and cytosol.
Cell membrane. Early endosome. Cytoplasm.
Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue.
Belongs to the protein-tyrosine phosphatase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.