HSP10 Antibody - #AF0183
Product: | HSP10 Antibody |
Catalog: | AF0183 |
Description: | Rabbit polyclonal antibody to HSP10 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 10kDa; 11kD(Calculated). |
Uniprot: | P61604 |
RRID: | AB_2833376 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0183, RRID:AB_2833376.
Fold/Unfold
10 kDa chaperonin; 10 kDa heat shock protein mitochondrial; 10 kDa heat shock protein, mitochondrial; CH10_HUMAN; Chaperonin 10; Chaperonin 10 homolog; CPN10; cpn10 homolog; Early pregnancy factor; Early-pregnancy factor; EPF; GROES; GroES homolog; Heat shock 10kD protein 1 chaperonin 10; Heat shock 10kDa protein 1; Heat shock 10kDa protein 1 chaperonin 10; Heat-shock 10-kD protein; Hsp10; Hspe1;
Immunogens
A synthesized peptide derived from human HSP10, corresponding to a region within the internal amino acids.
- P61604 CH10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Co-chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp60, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix. The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric rings of the co-chaperonin Hsp10. This leads to sequestration of the substrate protein in the inner cavity of Hsp60 where, for a certain period of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in the dissociation of the chaperonin rings and the release of ADP and the folded substrate protein (Probable).
Mitochondrion matrix.
Belongs to the GroES chaperonin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.