SEP15 Antibody - #DF8136
Product: | SEP15 Antibody |
Catalog: | DF8136 |
Description: | Rabbit polyclonal antibody to SEP15 |
Application: | WB IHC |
Reactivity: | Human, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Chicken, Xenopus |
Mol.Wt.: | 18 kDa; 18kD(Calculated). |
Uniprot: | O60613 |
RRID: | AB_2841471 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8136, RRID:AB_2841471.
Fold/Unfold
15 kDa selenoprotein; SELENOF; Selenoprotein F; Sep15; SEP15_HUMAN;
Immunogens
A synthesized peptide derived from human SEP15, corresponding to a region within the internal amino acids.
- O60613 SEP15_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May be involved in redox reactions associated with the formation of disulfide bonds (By similarity). May contribute to the quality control of protein folding in the endoplasmic reticulum. May regulate protein folding by enhancing the catalytic activity of UGGT1/UGCGL1 and UGGT2/UGCGL2.
The N-terminus is blocked.
Endoplasmic reticulum lumen.
Note: The association with UGGT1/UGCGL1 is essential for its retention in the endoplasmic reticulum.
Higher levels in prostate and thyroid gland.
Belongs to the selenoprotein M/F family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.