MBD2 Antibody - #DF8149
| Product: | MBD2 Antibody |
| Catalog: | DF8149 |
| Description: | Rabbit polyclonal antibody to MBD2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Xenopus |
| Mol.Wt.: | 43 kDa; 43kD(Calculated). |
| Uniprot: | Q9UBB5 |
| RRID: | AB_2841479 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8149, RRID:AB_2841479.
Fold/Unfold
Demethylase; DMTase; MBD 2; Mbd2; MBD2_HUMAN; MBD2a; Methyl CpG binding domain protein 2; Methyl CpG binding protein MBD2; Methyl-CpG-binding domain protein 2; Methyl-CpG-binding protein MBD2; NY CO 41;
Immunogens
- Q9UBB5 MBD2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UBB5 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R2 | Methylation | Uniprot | |
| S44 | Phosphorylation | Uniprot | |
| R61 | Methylation | Uniprot | |
| Y179 | Phosphorylation | Uniprot | |
| S181 | Phosphorylation | Uniprot | |
| S183 | Phosphorylation | Uniprot | |
| S189 | Phosphorylation | Uniprot | |
| K217 | Ubiquitination | Uniprot | |
| K253 | Acetylation | Uniprot | |
| K253 | Sumoylation | Uniprot | |
| S269 | Phosphorylation | Uniprot | |
| S293 | Phosphorylation | Uniprot | |
| T296 | Phosphorylation | Uniprot | |
| K382 | Ubiquitination | Uniprot | |
| S407 | Phosphorylation | Uniprot |
Research Backgrounds
Binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binds hemimethylated DNA as well. Recruits histone deacetylases and DNA methyltransferases. Acts as transcriptional repressor and plays a role in gene silencing. Functions as a scaffold protein, targeting GATAD2A and GATAD2B to chromatin to promote repression. May enhance the activation of some unmethylated cAMP-responsive promoters.
Nucleus.
Note: Nuclear, in discrete foci. Detected at replication foci in late S phase.
Highly expressed in brain, heart, kidney, stomach, testis and placenta.
Heterodimer with MBD3. Component of the MeCP1 complex that contains HDAC1 and HDAC2. Binds DNMT1, MIZF, GPN1, SIN3A, GATAD2A/p66-alpha and GATAD2B/p66-beta. Interacts with DHX9. Interacts with SPHK2.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.