UFM1 Antibody - #DF8177
| Product: | UFM1 Antibody |
| Catalog: | DF8177 |
| Description: | Rabbit polyclonal antibody to UFM1 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 9 kDa; 9kD(Calculated). |
| Uniprot: | P61960 |
| RRID: | AB_2841495 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8177, RRID:AB_2841495.
Fold/Unfold
BM 002; BM002; C13orf20; Chromosome 13 open reading frame 20; Ubiquitin fold modifier 1; Ubiquitin-fold modifier 1; UFM1; UFM1_HUMAN;
Immunogens
- P61960 UFM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P61960 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R15 | Methylation | Uniprot | |
| Y18 | Phosphorylation | Uniprot | |
| K19 | Ubiquitination | Uniprot | |
| S72 | Phosphorylation | Uniprot | |
| R75 | Methylation | Uniprot |
Research Backgrounds
Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to substrate proteins as a monomer or a lysine-linked polymer. The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1. This post-translational modification on lysine residues of proteins may play a crucial role in a number of cellular processes. TRIP4 ufmylation may for instance play a role in nuclear receptors-mediated transcription. Other substrates may include DDRGK1 with which it may play a role in the cellular response to endoplasmic reticulum stress (Probable).
Nucleus. Cytoplasm.
Interacts with UBA5. Interacts with UFC1.
Belongs to the UFM1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.