BGN Antibody - #DF8189
Product: | BGN Antibody |
Catalog: | DF8189 |
Description: | Rabbit polyclonal antibody to BGN |
Application: | WB IHC |
Reactivity: | Human, Rat |
Prediction: | Bovine, Horse, Sheep, Dog, Xenopus |
Mol.Wt.: | 41 kDa; 42kD(Calculated). |
Uniprot: | P21810 |
RRID: | AB_2841499 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8189, RRID:AB_2841499.
Fold/Unfold
BGN; Biglycan; Biglycan proteoglycan; Bone/cartilage proteoglycan I; Dermatan sulphate proteoglycan I; DSPG1; PG S1; PG-S1; PGI; PGS1_HUMAN; SEMDX; SLRR1A; Small leucine rich protein 1A;
Immunogens
- P21810 PGS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P21810 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S42 | O-Glycosylation | Uniprot | |
S47 | O-Glycosylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
K111 | Acetylation | Uniprot | |
S253 | Phosphorylation | Uniprot | |
N270 | N-Glycosylation | Uniprot | |
N311 | N-Glycosylation | Uniprot | |
K328 | Acetylation | Uniprot | |
K367 | Acetylation | Uniprot |
Research Backgrounds
May be involved in collagen fiber assembly.
The two attached glycosaminoglycan chains can be either chondroitin sulfate or dermatan sulfate.
Secreted>Extracellular space>Extracellular matrix.
Found in several connective tissues, especially in articular cartilages.
Homodimer. Forms a ternary complex with MFAP2 and ELN (By similarity).
Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.