PTRH2 Antibody - #DF8201
Product: | PTRH2 Antibody |
Catalog: | DF8201 |
Description: | Rabbit polyclonal antibody to PTRH2 |
Application: | WB |
Reactivity: | Human, Mouse |
Mol.Wt.: | 19 kDa; 19kD(Calculated). |
Uniprot: | Q9Y3E5 |
RRID: | AB_2841509 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8201, RRID:AB_2841509.
Fold/Unfold
Bcl 2 inhibitor of transcription 1; Bcl-2 inhibitor of transcription 1; BIT 1; BIT1; CGI 147; CGI147; mitochondrial; Peptidyl tRNA hydrolase 2 mitochondrial; Peptidyl-tRNA hydrolase 2; PTH 2; PTH2; PTH2_HUMAN; PTRH 2; PTRH2;
Immunogens
- Q9Y3E5 PTH2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
PTMs - Q9Y3E5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Ubiquitination | Uniprot | ||
S5 | Phosphorylation | Q15139 (PRKD1) | Uniprot |
T45 | Phosphorylation | Uniprot | |
K47 | Ubiquitination | Uniprot | |
T48 | Phosphorylation | Uniprot | |
T50 | Phosphorylation | Uniprot | |
T52 | Phosphorylation | Uniprot | |
S54 | Phosphorylation | Uniprot | |
S57 | Phosphorylation | Uniprot | |
S62 | Phosphorylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
K79 | Ubiquitination | Uniprot | |
K81 | Ubiquitination | Uniprot | |
S87 | Phosphorylation | Q15139 (PRKD1) | Uniprot |
Y94 | Phosphorylation | Uniprot | |
K95 | Ubiquitination | Uniprot | |
K106 | Acetylation | Uniprot | |
K106 | Ubiquitination | Uniprot | |
K115 | Ubiquitination | Uniprot | |
K119 | Ubiquitination | Uniprot | |
K134 | Ubiquitination | Uniprot | |
T139 | Phosphorylation | Uniprot | |
K171 | Ubiquitination | Uniprot | |
K177 | Ubiquitination | Uniprot |
Research Backgrounds
The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
Promotes caspase-independent apoptosis by regulating the function of two transcriptional regulators, AES and TLE1.
Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.
Mitochondrion.
Monomer.
Belongs to the PTH2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.