CDK5R2 Antibody - #DF8204
| Product: | CDK5R2 Antibody |
| Catalog: | DF8204 |
| Description: | Rabbit polyclonal antibody to CDK5R2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Dog |
| Mol.Wt.: | 39 kDa; 39kD(Calculated). |
| Uniprot: | Q13319 |
| RRID: | AB_2841512 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8204, RRID:AB_2841512.
Fold/Unfold
CD5R2_HUMAN; CDK5 activator 2; Cdk5r2; Cyclin dependent kinase 5 activator 2; Cyclin dependent kinase 5 activator isoform p39i; Cyclin dependent kinase 5 regulatory subunit 2; Cyclin-dependent kinase 5 activator 2; Cyclin-dependent kinase 5 regulatory subunit 2; NCK5AI; Neuronal CDK5 activator isoform; p39; P39I; p39nck5ai;
Immunogens
A synthesized peptide derived from human CDK5R2, corresponding to a region within the internal amino acids.
- Q13319 CD5R2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKHWTMNLDR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Activator of CDK5/TPKII.
Myristoylated. The Gly-2-Ala mutant is absent of the cell periphery, suggesting that a proper myristoylation signal is essential for the proper distribution of CDK5R2 (p39).
Cell membrane>Lipid-anchor>Cytoplasmic side.
Brain and neuron specific.
Belongs to the cyclin-dependent kinase 5 activator family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.