MLLT11 Antibody - #DF8213
| Product: | MLLT11 Antibody |
| Catalog: | DF8213 |
| Description: | Rabbit polyclonal antibody to MLLT11 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 10 kDa; 10kD(Calculated). |
| Uniprot: | Q13015 |
| RRID: | AB_2841518 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8213, RRID:AB_2841518.
Fold/Unfold
AF1Q; AF1Q_HUMAN; ALL1 fused gene from chromosome 1q; MLLT 11; MLLT11; Myeloid/lymphoid or mixed lineage leukemia (trithorax homolog, Drosophila) translocated to 11; Protein AF1q; RP11 316M1.10;
Immunogens
Expressed in myoepithelial cells of normal breast tissue (at protein level) (PubMed:26079538). Highly expressed in thymus (PubMed:7833468). Expressed in colon, small intestine, prostate and ovary. Not detected in peripheral blood lymphocytes and spleen (PubMed:7833468).
- Q13015 AF1Q_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13015 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S7 | Phosphorylation | Uniprot | |
| Y9 | Phosphorylation | Uniprot | |
| R16 | Methylation | Uniprot | |
| Y38 | Phosphorylation | Uniprot | |
| K39 | Ubiquitination | Uniprot | |
| K41 | Ubiquitination | Uniprot | |
| S44 | Phosphorylation | Uniprot | |
| K47 | Acetylation | Uniprot | |
| K47 | Ubiquitination | Uniprot | |
| K59 | Ubiquitination | Uniprot | |
| Y69 | Phosphorylation | Uniprot | |
| S81 | Phosphorylation | Uniprot | |
| S84 | Phosphorylation | Uniprot |
Research Backgrounds
Cofactor for the transcription factor TCF7. Involved in regulation of lymphoid development by driving multipotent hematopoietic progenitor cells towards a T cell fate.
Ubiquitinated, leading to degradation.
Nucleus. Cytoplasm. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Note: Continuous nuclear export is followed by degradation.
Expressed in myoepithelial cells of normal breast tissue (at protein level). Highly expressed in thymus. Expressed in colon, small intestine, prostate and ovary. Not detected in peripheral blood lymphocytes and spleen.
Interacts with HSPA8 and LAMP2 isoform A; the interaction may target MLLT11 for degradation via chaperone-mediated autophagy. Interacts with TCF7.
Belongs to the MLLT11 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.