COPS8 Antibody - #DF8239
Product: | COPS8 Antibody |
Catalog: | DF8239 |
Description: | Rabbit polyclonal antibody to COPS8 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 23 kDa; 23kD(Calculated). |
Uniprot: | Q99627 |
RRID: | AB_2841535 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8239, RRID:AB_2841535.
Fold/Unfold
COP9 homolog; COP9 signalosome complex subunit 8; COP9 signalosome subunit 8; Cops8; CSN8; CSN8_HUMAN; hCOP9; JAB1 containing signalosome subunit 8; JAB1-containing signalosome subunit 8; SGN8; Signalosome subunit 8;
Immunogens
- Q99627 CSN8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99627 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K65 | Ubiquitination | Uniprot | |
S69 | Phosphorylation | Uniprot | |
K166 | Ubiquitination | Uniprot | |
S175 | Phosphorylation | Uniprot | |
K178 | Ubiquitination | Uniprot | |
Y203 | Phosphorylation | Uniprot |
Research Backgrounds
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
Cytoplasm. Nucleus.
Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1. In the complex, it probably interacts directly with COPS3, COPS4 and COPS7 (COPS7A or COPS7B).
Belongs to the CSN8 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.