UBE2M Antibody - #DF8243
| Product: | UBE2M Antibody |
| Catalog: | DF8243 |
| Description: | Rabbit polyclonal antibody to UBE2M |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Rabbit, Dog |
| Mol.Wt.: | 21 kDa; 21kD(Calculated). |
| Uniprot: | P61081 |
| RRID: | AB_2841538 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8243, RRID:AB_2841538.
Fold/Unfold
hUbc12; NEDD8 carrier protein; NEDD8 conjugating enzyme Ubc12; NEDD8 protein ligase; NEDD8-conjugating enzyme Ubc12; UBC-RS2; UBC12; UBC12_HUMAN; ube2m; ubiquitin carrier protein M; Ubiquitin conjugating enzyme E2 M; Ubiquitin-conjugating enzyme E2 M; ubiquitin-protein ligase M; yeast UBC12 homolog;
Immunogens
A synthesized peptide derived from human UBE2M, corresponding to a region within the internal amino acids.
- P61081 UBC12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation.
The acetylation of Met-1 increases affinity for DCUN1D1 by about 2 orders of magnitude and is crucial for NEDD8 transfer to cullins.
Both the N-terminal docking peptide and the catalytic core domain must bind the UBA3-NAE1 complex simultaneously for optimal transfer of NEDD8.
Belongs to the ubiquitin-conjugating enzyme family. UBC12 subfamily.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.