Galectin 8 Antibody - #DF8262
| Product: | Galectin 8 Antibody |
| Catalog: | DF8262 |
| Description: | Rabbit polyclonal antibody to Galectin 8 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 40 kDa; 36kD(Calculated). |
| Uniprot: | O00214 |
| RRID: | AB_2841551 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8262, RRID:AB_2841551.
Fold/Unfold
Gal 8; Gal-8; Gal8; Galectin-8; galectin-8g; Lectin galactoside binding soluble 8; LEG8_HUMAN; LGAL S8; Lgals8; PCTA 1; PCTA-1; PCTA1; Po66 carbohydrate binding protein; Po66 carbohydrate-binding protein; Po66 CBP; Po66-CBP; Prostate carcinoma tumor antigen 1;
Immunogens
Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
- O00214 LEG8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00214 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S54 | Phosphorylation | Uniprot | |
| S55 | Phosphorylation | Uniprot | |
| K57 | Ubiquitination | Uniprot | |
| K85 | Ubiquitination | Uniprot | |
| K98 | Ubiquitination | Uniprot | |
| K134 | Ubiquitination | Uniprot | |
| Y141 | Phosphorylation | Uniprot | |
| K177 | Ubiquitination | Uniprot | |
| T193 | Phosphorylation | Uniprot | |
| T200 | Phosphorylation | Uniprot | |
| K204 | Ubiquitination | Uniprot | |
| K212 | Ubiquitination | Uniprot | |
| K222 | Ubiquitination | Uniprot | |
| K224 | Ubiquitination | Uniprot | |
| K237 | Ubiquitination | Uniprot | |
| K291 | Ubiquitination | Uniprot |
Research Backgrounds
Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.
Cytoplasmic vesicle. Cytoplasm>Cytosol.
Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
Homodimer Ref.15). Interacts with CALCOCO2/NDP52. Interacts with PDPN; the interaction is glycosylation-dependent; may participate to connection of the lymphatic endothelium to the surrounding extracellular matrix.
Contains two homologous but distinct carbohydrate-binding domains.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.