CD53 Antibody - #DF8263
| Product: | CD53 Antibody |
| Catalog: | DF8263 |
| Description: | Rabbit polyclonal antibody to CD53 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | P19397 |
| RRID: | AB_2841552 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8263, RRID:AB_2841552.
Fold/Unfold
AI323659; Antigen MOX44 identified by monoclonal antibody MRC-OX44; CD 53; CD53; CD53 antigen; CD53 antigen, isoform CRA_b; CD53 glycoprotein; Cd53 molecule; CD53 tetraspan antigen; CD53_HUMAN; Cell surface glycoprotein CD53; Leukocyte antigen MRC OX-44; Leukocyte surface antigen CD53; MOX 44; MOX44; OTTHUMP00000059505; Ox-44; OX44; RATOX44; Tetraspanin 25; Tetraspanin-25; Tetraspanin25; Transmembrane glycoprotein; TSPAN 25; Tspan-25; TSPAN25;
Immunogens
B-cells, monocytes, macrophages, neutrophils, single (CD4 or CD8) positive thymocytes and peripheral T-cells.
- P19397 CD53_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P19397 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K116 | Ubiquitination | Uniprot | |
| K166 | Ubiquitination | Uniprot |
Research Backgrounds
Required for efficient formation of myofibers in regenerating muscle at the level of cell fusion. May be involved in growth regulation in hematopoietic cells (By similarity).
Cell membrane. Cell junction. Membrane>Multi-pass membrane protein.
Note: Concentrates in localized microdomains along the plasma membrane at the contact sites between cells of fused myotubes.
B-cells, monocytes, macrophages, neutrophils, single (CD4 or CD8) positive thymocytes and peripheral T-cells.
Interacts with SCIMP.
Belongs to the tetraspanin (TM4SF) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.