CD82 Antibody - #DF8267
Product: | CD82 Antibody |
Catalog: | DF8267 |
Description: | Rabbit polyclonal antibody to CD82 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine |
Mol.Wt.: | 30 kDa; 30kD(Calculated). |
Uniprot: | P27701 |
RRID: | AB_2841556 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8267, RRID:AB_2841556.
Fold/Unfold
4F9; Antigen detected by monoclonal and antibody IA4; C33; C33 antigen; CD 82; CD82; CD82 antigen; CD82 molecule; CD82_HUMAN; GR 15; GR15; IA 4; IA4; Inducible membrane protein; Inducible membrane protein R2; KAI 1; KAI1; Kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)); Kangai 1; Kangai1; Leukocyte surface antigen R2; Metastasis suppressor Kangai 1; Metastasis suppressor Kangai-1; Metastasis suppressor Kangai1; Prostate cancer antimetastasis gene KAI1; R2; R2 leukocyte antigen; SAR 2; SAR2; ST 6; ST6; Suppression of tumorigenicity 6; Suppression of tumorigenicity 6 prostate; Suppressor of tumorigenicity 6; Suppressor of tumorigenicity 6 protein; Tetraspanin 27; Tetraspanin-27; Tetraspanin27; Tspan 27; Tspan-27; Tspan27;
Immunogens
A synthesized peptide derived from human CD82, corresponding to a region within the internal amino acids.
- P27701 CD82_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Cell membrane>Multi-pass membrane protein.
Lymphoid specific.
Belongs to the tetraspanin (TM4SF) family.
Research Fields
· Cellular Processes > Cell growth and death > p53 signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.