IFITM3 Antibody - #DF8270
(1)
(2)
| Product: | IFITM3 Antibody |
| Catalog: | DF8270 |
| Description: | Rabbit polyclonal antibody to IFITM3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Sheep |
| Mol.Wt.: | 15 kDa; 15kD(Calculated). |
| Uniprot: | Q01628 |
| RRID: | AB_2841559 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8270, RRID:AB_2841559.
Fold/Unfold
1 8U; Fragilis; IFITM3; IFM3_HUMAN; Interferon induced transmembrane protein 3 (1 8U); Interferon Induced Transmembrane Protein 3; Interferon inducible; Interferon inducible protein 1 8U; Interferon Inducible Protein 15; Interferon Inducible Protein Homolog; Interferon-induced transmembrane protein 3; Interferon-inducible protein 1-8U; IP15;
Immunogens
- Q01628 IFM3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q01628 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S10 | Phosphorylation | Uniprot | |
| Y20 | Phosphorylation | P06241 (FYN) | Uniprot |
| K24 | Ubiquitination | Uniprot | |
| T42 | Phosphorylation | Uniprot | |
| T52 | Phosphorylation | Uniprot | |
| K83 | Ubiquitination | Uniprot | |
| K88 | Ubiquitination | Uniprot | |
| T94 | Phosphorylation | Uniprot | |
| Y99 | Phosphorylation | Uniprot | |
| K104 | Ubiquitination | Uniprot |
Research Backgrounds
IFN-induced antiviral protein which disrupts intracellular cholesterol homeostasis. Inhibits the entry of viruses to the host cell cytoplasm by preventing viral fusion with cholesterol depleted endosomes. May inactivate new enveloped viruses which buds out of the infected cell, by letting them go out with a cholesterol depleted membrane. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV) and Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and vesicular stomatitis virus (VSV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV S protein-mediated viral entry and VSV G protein-mediated viral entry. Plays a critical role in the structural stability and function of vacuolar ATPase (v-ATPase). Establishes physical contact with the v-ATPase of endosomes which is critical for proper clathrin localization and is also required for the function of the v-ATPase to lower the pH in phagocytic endosomes thus establishing an antiviral state.
Palmitoylation on membrane-proximal cysteines controls clustering in membrane compartments and antiviral activity against influenza virus.
Not glycosylated.
Polyubiquitinated with both 'Lys-48' and 'Lys-63' linkages. Ubiquitination negatively regulates antiviral activity. Lys-24 is the most prevalent ubiquitination site.
Cell membrane>Single-pass type II membrane protein. Late endosome membrane>Single-pass type II membrane protein. Lysosome membrane>Single-pass type II membrane protein.
Interacts with ATP6V0B and CD81 (By similarity). Interacts with SPP1; the interaction reduces OPN expression. Interacts with VAPA.
Belongs to the CD225/Dispanin family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.