Product: MYOG Antibody
Catalog: DF8273
Description: Rabbit polyclonal antibody to MYOG
Application: WB
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 25 kDa(Observed); 25kD(Calculated).
Uniprot: P15173
RRID: AB_2841562

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%)
Clonality:
Polyclonal
Specificity:
MYOG Antibody detects endogenous levels of total MYOG.
RRID:
AB_2841562
Cite Format: Affinity Biosciences Cat# DF8273, RRID:AB_2841562.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

bHLHc3; cb553; Class C basic helix-loop-helix protein 3; MYF 4; Myf-4; MYF4; MYOG; MYOG_HUMAN; Myogenic factor 4; Myogenic factor 4 myogenin; Myogenin; Myogenin myogenin factor 4; OTTHUMP00000039094;

Immunogens

Immunogen:

A synthesized peptide derived from human MYOG, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Sequence:
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation, cell cycle exit and muscle atrophy. Essential for the development of functional embryonic skeletal fiber muscle differentiation. However is dispensable for postnatal skeletal muscle growth; phosphorylation by CAMK2G inhibits its transcriptional activity in respons to muscle activity. Required for the recruitment of the FACT complex to muscle-specific promoter regions, thus promoting gene expression initiation. During terminal myoblast differentiation, plays a role as a strong activator of transcription at loci with an open chromatin structure previously initiated by MYOD1. Together with MYF5 and MYOD1, co-occupies muscle-specific gene promoter core regions during myogenesis. Cooperates also with myocyte-specific enhancer factor MEF2D and BRG1-dependent recruitment of SWI/SNF chromatin-remodeling enzymes to alter chromatin structure at myogenic late gene promoters. Facilitates cell cycle exit during terminal muscle differentiation through the up-regulation of miR-20a expression, which in turn represses genes involved in cell cycle progression. Binds to the E-box containing (E1) promoter region of the miR-20a gene. Plays also a role in preventing reversal of muscle cell differentiation. Contributes to the atrophy-related gene expression in adult denervated muscles. Induces fibroblasts to differentiate into myoblasts (By similarity).

PTMs:

Phosphorylated by CAMK2G on threonine and serine amino acids in a muscle activity-dependent manner. Phosphorylation of Thr-87 impairs both DNA-binding and trans-activation functions in contracting muscles (By similarity).

Subcellular Location:

Nucleus.
Note: Recruited to late myogenic gene promoter regulatory sequences with SMARCA4/BRG1/BAF190A and SWI/SNF chromatin-remodeling enzymes to promote chromatin-remodeling and transcription initiation in developing embryos.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

References

1). Effect of traction therapy on muscle satellite cell proliferation and differentiation in a rat model of knee stiffness. Stem cell research & therapy, 2024 (PubMed: 39707518) [IF=7.5]

Application: WB    Species: Rat    Sample:

Fig. 3 Results of protein expression levels of MyoD1, Pax7, Myf5 and MyoG. (A) Western blot of MyoG, Myf5, Pax7, MyoD1, and GAPDH. (B, C) Quantitative results of protein expression in rectus femoris muscle of each group on 10 and 20 days of traction treatment, respectively (n = 8). *P 

2). Paeoniflorin Ameliorates Skeletal Muscle Atrophy in Chronic Kidney Disease via AMPK/SIRT1/PGC-1α-Mediated Oxidative Stress and Mitochondrial Dysfunction. Frontiers in Pharmacology, 2022 (PubMed: 35370668) [IF=5.6]

Application: IF/ICC    Species: rat    Sample: GA muscle

FIGURE 2 | PF inhibited skeletal muscle atrophy in CKD model rats.(J) Sections of GA muscle from different groups were examined with immunofluorescence staining (200×) using anti MyoD (red), anti MyoG (red) and DAPI (blue).

Application: WB    Species: rat    Sample: GA muscle

FIGURE 2 | PF inhibited skeletal muscle atrophy in CKD model rats.(L) Representative immunoblotting of MAFbx, MuRF-1, MyoD, MyoG and GAPDH.

3). oar-miR-411a-5p Promotes Proliferation and Differentiation in Hu Sheep Myoblasts Under Heat Stress by Targeting SMAD2. Journal of cellular physiology, 2025 (PubMed: 39718049) [IF=4.5]

4). Kcnma1 is involved in mitochondrial homeostasis in diabetes-related skeletal muscle atrophy. The FASEB Journal, 2023 (PubMed: 36929614) [IF=4.4]

5). DYRK1A Overexpression Drives Muscle Wasting by Impeding Myogenesis via a USP7-Axin1-β-Catenin Regulatory Axis in Mice. IUBMB life, 2025 (PubMed: 40970570) [IF=3.7]

6). Porcine Skeletal Muscle-Specific lncRNA-ssc.37456 Regulates Myoblast Proliferation and Differentiation. Animals : an open access journal from MDPI, 2026 (PubMed: 41681344) [IF=2.7]

7). Overexpression of Dnmt3a ameliorates diabetic muscle atrophy by modulating Pten/Akt pathway. EXPERIMENTAL PHYSIOLOGY, 2020 (PubMed: 32964508) [IF=2.6]

Application: WB    Species: mouse    Sample: tibialis anterior muscles

FIGURE 3 |Overexpression of Dnmt3a restores the expression of myogenic regulatory factors in diabetic mice. (a) Real-time PCR analysis of relative mRNA levels of atrogin-1, MuRF1, Pax7, Myod1 and Myog in tibialis anterior muscles from the Control group, STZ group, STZ+Vector group and STZ+Dnmt3a group. (b) Western blot analysis of relative protein levels of atrogin-1, MuRF1, Pax7, Myod1 and Myog in tibialis anterior muscles from each group. n = 6 mice per group; **P < 0.01, ***P < 0.001

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.