RETN Antibody - #DF8288
| Product: | RETN Antibody |
| Catalog: | DF8288 |
| Description: | Rabbit polyclonal antibody to RETN |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 11 kDa; 11kD(Calculated). |
| Uniprot: | Q9HD89 |
| RRID: | AB_2841574 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8288, RRID:AB_2841574.
Fold/Unfold
Adipose tissue specific secretory factor; Adipose tissue-specific secretory factor; ADSF; C/EBP epsilon regulated myeloid specific secreted cysteine rich protein; C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 1; C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; CG5403; Cysteine rich secreted protein A12 alpha like 2; Cysteine rich secreted protein FIZZ3; Cysteine-rich secreted protein A12-alpha-like 2; Cysteine-rich secreted protein FIZZ3; dri; FIZZ 3; FIZZ3; Found in inflammatory zone 3; HXCP 1; HXCP1; MGC126603; MGC126609; PRO1199; Resistin; Resistin delta2; RETN 1; RETN; RETN_HUMAN; RETN1; RSTN; UNQ407; XCP 1; XCP1;
Immunogens
A synthesized peptide derived from human RETN, corresponding to a region within the internal amino acids.
Expressed in white adipose tissue (at protein level) (PubMed:11201732). Widely expressed, with particularly strong expression in lung, bone marrow, breast and peripheral blood (PubMed:15248836). Expressed strongly in bone marrow and at lower levels in lung, but not detected in other tissues (PubMed:15064728). Isoform 2 is detected in adipose tissue, bone marrow, brain, lung, peripheral blood, placenta and thymus (PubMed:15248836).
- Q9HD89 RETN_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells (By similarity). Potentially links obesity to diabetes (By similarity). Promotes chemotaxis in myeloid cells.
Secreted.
Expressed in white adipose tissue (at protein level). Widely expressed, with particularly strong expression in lung, bone marrow, breast and peripheral blood. Expressed strongly in bone marrow and at lower levels in lung, but not detected in other tissues. Isoform 2 is detected in adipose tissue, bone marrow, brain, lung, peripheral blood, placenta and thymus.
Belongs to the resistin/FIZZ family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.