S100P Antibody - #DF8292
| Product: | S100P Antibody |
| Catalog: | DF8292 |
| Description: | Rabbit polyclonal antibody to S100P |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Horse, Dog |
| Mol.Wt.: | 10 kDa; 10kD(Calculated). |
| Uniprot: | P25815 |
| RRID: | AB_2841577 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8292, RRID:AB_2841577.
Fold/Unfold
MIG9; Migration inducing gene 9; Protein S100-E; Protein S100-P; Protein S100P; S100 calcium binding protein P; S100 calcium-binding protein P; S100 P; S100E; S100P; S100P_HUMAN;
Immunogens
Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreatic intraepithelial neoplasias.
- P25815 S100P_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P25815 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T2 | Phosphorylation | Uniprot | |
| S21 | Phosphorylation | Uniprot | |
| S24 | Phosphorylation | Uniprot | |
| T25 | Phosphorylation | Uniprot | |
| K30 | Ubiquitination | Uniprot | |
| K39 | Ubiquitination | Uniprot | |
| K49 | Acetylation | Uniprot | |
| K49 | Ubiquitination | Uniprot | |
| K56 | Ubiquitination | Uniprot | |
| K91 | Ubiquitination | Uniprot |
Research Backgrounds
May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the formation of microvilli in epithelial cells. May stimulate cell proliferation in an autocrine manner via activation of the receptor for activated glycation end products (RAGE).
Nucleus. Cytoplasm. Cell projection>Microvillus membrane.
Note: Colocalizes with S100PBP in the nucleus. Colocolizes with EZR in the microvilli in a calcium-dependent manner.
Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreatic intraepithelial neoplasias.
Homodimer and heterodimer with S100A1. Interacts with S100PBP and S100Z. Interacts with CACYBP in a calcium-dependent manner. Dimeric form binds to and activates EZR/Ezrin by unmasking its F-actin binding sites. Interacts with PPP5C (via TPR repeats); the interaction is calcium-dependent and modulates PPP5C activity.
Belongs to the S-100 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.