SIRT5 Antibody - #DF8294

Product: | SIRT5 Antibody |
Catalog: | DF8294 |
Description: | Rabbit polyclonal antibody to SIRT5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 34 kDa; 34kD(Calculated). |
Uniprot: | Q9NXA8 |
RRID: | AB_2841579 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8294, RRID:AB_2841579.
Fold/Unfold
NAD dependent deacetylase sirtuin 5; NAD dependent lysine demalonylase and desuccinylase sirtuin 5 mitochondrial; NAD dependent protein deacylase sirtuin 5 mitochondrial; NAD-dependent protein deacylase sirtuin-5, mitochondrial; Regulatory protein SIR2 homolog 5; Silent mating type information regulation 2 S.cerevisiae homolog 5; Sir2 like 5; SIR2-like protein 5; SIR2L5; SIR5_HUMAN; Sirt5; Sirtuin 5; Sirtuin type 5;
Immunogens
- Q9NXA8 SIR5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NXA8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y76 | Phosphorylation | Uniprot | |
T87 | Phosphorylation | Uniprot | |
S160 | Phosphorylation | Uniprot | |
K203 | Ubiquitination | Uniprot |
Research Backgrounds
NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting. Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species. Activates SHMT2 by mediating its desuccinylation. Modulates ketogenesis through the desuccinylation and activation of HMGCS2 (By similarity). Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as UOX.
Mitochondrion matrix. Mitochondrion intermembrane space. Cytoplasm>Cytosol. Nucleus.
Note: Mainly mitochondrial. Also present extramitochondrially, with a fraction present in the cytosol and very small amounts also detected in the nucleus.
Cytoplasm. Mitochondrion.
Mitochondrion.
Widely expressed.
Interacts with CPS1 (By similarity). Interacts with PCCA. Monomer. Homodimer. Forms homodimers upon suramin binding.
In contrast to class I sirtuins, class III sirtuins have only weak deacetylase activity. Difference in substrate specificity is probably due to a larger hydrophobic pocket with 2 residues (Tyr-102 and Arg-105) that bind to malonylated and succinylated substrates and define the specificity (PubMed:22076378).
Belongs to the sirtuin family. Class III subfamily.
References
Application: WB Species: Human Sample: ccRCC
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.