IL22 Antibody - #DF8343

Product: | IL22 Antibody |
Catalog: | DF8343 |
Description: | Rabbit polyclonal antibody to IL22 |
Application: | WB |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Dog |
Mol.Wt.: | 20 kDa; 20kD(Calculated). |
Uniprot: | Q9GZX6 |
RRID: | AB_2841610 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8343, RRID:AB_2841610.
Fold/Unfold
Cytokine Zcyto18; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; IL-10-related T-cell-derived-inducible factor; IL-22; IL-TIF; IL21; Il22; IL22_HUMAN; ILD110; ILTIF; Interleukin 10 related T cell derived inducible factor; interleukin 21; Interleukin 22; Interleukin-22; MGC79382; MGC79384; TIFa; TIFIL 23; TIFIL23; UNQ3099/PRO10096; zcyto18;
Immunogens
A synthesized peptide derived from human IL22, corresponding to a region within the internal amino acids.
- Q9GZX6 IL22_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Cytokine that contributes to the inflammatory response in vivo.
Secreted.
Belongs to the IL-10 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
References
Application: WB Species: Pig Sample: colonic mucosa
Application: WB Species: Mice Sample: colon tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.