| Product: | DCTN3 Antibody |
| Catalog: | DF8351 |
| Description: | Rabbit polyclonal antibody to DCTN3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 21 kDa(Observed); 21kD(Calculated). |
| Uniprot: | O75935 |
| RRID: | AB_2841616 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8351, RRID:AB_2841616.
Fold/Unfold
DCNT22; DCTN 22; DCTN22; Dctn3; DCTN3_HUMAN; dynactin 3 (p22); dynactin 3; dynactin 3 isoform 1; Dynactin complex subunit 22 kDa subunit; dynactin light chain; Dynactin subunit 3; p22;
Immunogens
A synthesized peptide derived from human DCTN3, corresponding to a region within N-terminal amino acids.
Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.
- O75935 DCTN3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPAEE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Together with dynein may be involved in spindle assembly and cytokinesis.
Cytoplasm. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Chromosome>Centromere>Kinetochore. Cytoplasm>Cytoskeleton>Spindle. Cleavage furrow. Midbody.
Note: Localizes to punctate cytoplasmic structures and to the centrosome during interphase, and to kinetochores and to spindle poles throughout mitosis. Colocalizes with dynein to the cleavage furrow and to midbody of dividing cells.
Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.
Belongs to the dynactin subunit 3 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.