COPS7A Antibody - #DF8375
| Product: | COPS7A Antibody |
| Catalog: | DF8375 |
| Description: | Rabbit polyclonal antibody to COPS7A |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 30 kDa; 30kD(Calculated). |
| Uniprot: | Q9UBW8 |
| RRID: | AB_2841637 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8375, RRID:AB_2841637.
Fold/Unfold
COP9 complex subunit 7a; COP9 constitutive photomorphogenic homolog subunit 7A; COP9 signalosome complex subunit 7a; COP9 signalosome subunit 7A; COPS7A; CSN7A; CSN7A_HUMAN; Dermal papilla derived protein 10; Dermal papilla-derived protein 10; DERP10; JAB1 containing signalosome subunit 7a; JAB1-containing signalosome subunit 7a; SGN7a; Signalosome subunit 7a;
Immunogens
A synthesized peptide derived from human COPS7A, corresponding to a region within C-terminal amino acids.
- Q9UBW8 CSN7A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
Phosphorylated by CK2 and PKD kinases.
Cytoplasm. Nucleus.
Widely expressed. Expressed at high level in brain, heart and skeletal muscle.
Belongs to the CSN7/EIF3M family. CSN7 subfamily.
References
Application: WB Species: Human Sample: normozoospermia and asthenozoospermia samples
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.