ARL4A Antibody - #DF8378
Product: | ARL4A Antibody |
Catalog: | DF8378 |
Description: | Rabbit polyclonal antibody to ARL4A |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 23 kDa; 23kD(Calculated). |
Uniprot: | P40617 |
RRID: | AB_2841640 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8378, RRID:AB_2841640.
Fold/Unfold
ADP ribosylation factor like 4; ADP ribosylation factor like 4A; ADP ribosylation factor like GTPase 4A; ADP-ribosylation factor-like protein 4A; ARL 4; ARL4; Arl4a; ARL4A_HUMAN;
Immunogens
A synthesized peptide derived from human ARL4A, corresponding to a region within the internal amino acids.
- P40617 ARL4A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
Myristoylated.
Cell membrane. Cytoplasm. Nucleus>Nucleolus.
Note: Localization in the nucleolus is dependent by nucleotide binding.
Belongs to the small GTPase superfamily. Arf family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.