TLS/FUS Antibody - #DF8391
| Product: | TLS/FUS Antibody |
| Catalog: | DF8391 |
| Description: | Rabbit polyclonal antibody to TLS/FUS |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 70kD(Observed); 53kD(Calculated). |
| Uniprot: | P35637 |
| RRID: | AB_2841647 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8391, RRID:AB_2841647.
Fold/Unfold
75 kDa DNA pairing protein; 75 kDa DNA-pairing protein; ALS6; Amyotrophic lateral sclerosis 6; fus; FUS CHOP; Fus like protein; FUS_HUMAN; FUS1; Fused in sarcoma; Fusion (involved in t(12;16) in malignant liposarcoma); Fusion derived from t(12;16) malignant liposarcoma; Fusion gene in myxoid liposarcoma; Heterogeneous nuclear ribonucleoprotein P2; hnRNP P2; hnRNPP2; Oncogene FUS; Oncogene TLS; POMp75; RNA binding protein FUS; RNA-binding protein FUS; TLS; TLS CHOP; Translocated in liposarcoma; Translocated in liposarcoma protein;
Immunogens
A synthesized peptide derived from human TLS/FUS, corresponding to a region within C-terminal amino acids.
- P35637 FUS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
DNA/RNA-binding protein that plays a role in various cellular processes such as transcription regulation, RNA splicing, RNA transport, DNA repair and damage response. Binds to nascent pre-mRNAs and acts as a molecular mediator between RNA polymerase II and U1 small nuclear ribonucleoprotein thereby coupling transcription and splicing. Binds also its own pre-mRNA and autoregulates its expression; this autoregulation mechanism is mediated by non-sense-mediated decay. Plays a role in DNA repair mechanisms by promoting D-loop formation and homologous recombination during DNA double-strand break repair. In neuronal cells, plays crucial roles in dendritic spine formation and stability, RNA transport, mRNA stability and synaptic homeostasis (By similarity).
Arg-216 and Arg-218 are dimethylated, probably to asymmetric dimethylarginine.
Phosphorylated in its N-terminal serine residues upon induced DNA damage. ATM and DNA-PK are able to phosphorylate FUS N-terminal region.
Nucleus.
Note: Displays a punctate pattern inside the nucleus and is excluded from nucleoli.
Ubiquitous.
Belongs to the RRM TET family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
References
Application: WB Species: human Sample: breast cancer cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.