MEMO1 Antibody - #DF8410
| Product: | MEMO1 Antibody |
| Catalog: | DF8410 |
| Description: | Rabbit polyclonal antibody to MEMO1 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig, Zebrafish, Bovine, Xenopus |
| Mol.Wt.: | 33 kDa; 34kD(Calculated). |
| Uniprot: | Q9Y316 |
| RRID: | AB_2841661 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8410, RRID:AB_2841661.
Fold/Unfold
C21orf19-like protein; C2orf4; CGI 27; DKFZp434I0135; FLJ25031; HCV NS5A-transactivated protein 7; Hepatitis C virus NS5A-transactivated protein 7; Mediator of cell motility 1; Mediator of ErbB2-driven cell motility 1; MEMO; Memo-1; memo1; MEMO1_HUMAN; NS5ATP7; Protein MEMO1;
Immunogens
- Q9Y316 MEMO1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y316 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S37 | Phosphorylation | Uniprot | |
| T38 | Phosphorylation | Uniprot | |
| S80 | Phosphorylation | Uniprot | |
| K108 | Ubiquitination | Uniprot | |
| K115 | Ubiquitination | Uniprot | |
| K148 | Ubiquitination | Uniprot | |
| K165 | Ubiquitination | Uniprot | |
| K171 | Ubiquitination | Uniprot | |
| S174 | Phosphorylation | Uniprot | |
| Y199 | Phosphorylation | Uniprot | |
| S200 | Phosphorylation | Uniprot | |
| Y201 | Phosphorylation | Uniprot | |
| Y202 | Phosphorylation | Uniprot | |
| Y210 | Phosphorylation | Uniprot | |
| K238 | Ubiquitination | Uniprot | |
| T295 | Phosphorylation | Uniprot |
Research Backgrounds
May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.
Interacts with ERBB2 phosphorylated on 'Tyr-1248'.
Belongs to the MEMO1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.