Product: EPS8 Antibody
Catalog: DF8413
Description: Rabbit polyclonal antibody to EPS8
Application: WB
Reactivity: Human
Prediction: Pig, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 92 kDa; 92kD(Calculated).
Uniprot: Q12929
RRID: AB_2841663

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Prediction:
Pig(100%), Horse(89%), Sheep(100%), Rabbit(100%), Dog(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
EPS8 Antibody detects endogenous levels of total EPS8.
RRID:
AB_2841663
Cite Format: Affinity Biosciences Cat# DF8413, RRID:AB_2841663.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Epidermal growth factor receptor kinase substrate 8; Epidermal growth factor receptor pathway substrate 8; EPS 8; EPS8; EPS8_HUMAN;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q12929 EPS8_HUMAN:

Expressed in all tissues analyzed, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed in all epithelial and fibroblastic lines examined and in some, but not all, hematopoietic cells.

Sequence:
MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Sheep
100
Dog
100
Xenopus
100
Rabbit
100
Horse
89
Bovine
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q12929 As Substrate

Site PTM Type Enzyme
Y22 Phosphorylation
S25 Phosphorylation
Y45 Phosphorylation
Y51 Phosphorylation
S55 Phosphorylation
S57 Phosphorylation
S58 Phosphorylation
S63 Phosphorylation
Y65 Phosphorylation
K188 Acetylation
K191 Acetylation
K193 Acetylation
S203 Phosphorylation
T223 Phosphorylation
S231 Phosphorylation
K248 Ubiquitination
Y252 Phosphorylation
S295 Phosphorylation
S298 Phosphorylation
K302 Acetylation
K305 Acetylation
T317 Phosphorylation
Y429 Phosphorylation
Y454 Phosphorylation
S476 Phosphorylation
T477 Phosphorylation
S480 Phosphorylation
S481 Phosphorylation
S483 Phosphorylation
Y485 Phosphorylation
Y491 Phosphorylation
S494 Phosphorylation
S495 Phosphorylation
Y498 Phosphorylation
T499 Phosphorylation
S502 Phosphorylation
T516 Phosphorylation
S517 Phosphorylation
Y525 Phosphorylation
T530 Phosphorylation
Y540 Phosphorylation
S548 Phosphorylation
S574 Phosphorylation
S577 Phosphorylation
Y602 Phosphorylation
T603 Phosphorylation
T605 Phosphorylation
T620 Phosphorylation
S625 Phosphorylation P27361 (MAPK3)
T629 Phosphorylation P27361 (MAPK3)
T641 Phosphorylation
T655 Phosphorylation
S659 Phosphorylation
S660 Phosphorylation
S661 Phosphorylation
S662 Phosphorylation
S664 Phosphorylation
S667 Phosphorylation
S672 Phosphorylation
S685 Phosphorylation
T699 Phosphorylation
T722 Phosphorylation
Y723 Phosphorylation
S725 Phosphorylation
T726 Phosphorylation
T743 Phosphorylation
T765 Phosphorylation
Y774 Phosphorylation
S775 Phosphorylation
K781 Ubiquitination
S787 Phosphorylation
S790 Phosphorylation
S791 Phosphorylation
S809 Phosphorylation
S811 Phosphorylation
S815 Phosphorylation
S820 Phosphorylation
S821 Phosphorylation

Research Backgrounds

Function:

Signaling adapter that controls various cellular protrusions by regulating actin cytoskeleton dynamics and architecture. Depending on its association with other signal transducers, can regulate different processes. Together with SOS1 and ABI1, forms a trimeric complex that participates in transduction of signals from Ras to Rac by activating the Rac-specific guanine nucleotide exchange factor (GEF) activity. Acts as a direct regulator of actin dynamics by binding actin filaments and has both barbed-end actin filament capping and actin bundling activities depending on the context. Displays barbed-end actin capping activity when associated with ABI1, thereby regulating actin-based motility process: capping activity is auto-inhibited and inhibition is relieved upon ABI1 interaction. Also shows actin bundling activity when associated with BAIAP2, enhancing BAIAP2-dependent membrane extensions and promoting filopodial protrusions. Involved in the regulation of processes such as axonal filopodia growth, stereocilia length, dendritic cell migration and cancer cell migration and invasion. Acts as a regulator of axonal filopodia formation in neurons: in the absence of neurotrophic factors, negatively regulates axonal filopodia formation via actin-capping activity. In contrast, it is phosphorylated in the presence of BDNF leading to inhibition of its actin-capping activity and stimulation of filopodia formation. Component of a complex with WHRN and MYO15A that localizes at stereocilia tips and is required for elongation of the stereocilia actin core. Indirectly involved in cell cycle progression; its degradation following ubiquitination being required during G2 phase to promote cell shape changes.

PTMs:

Ubiquitinated by the SCF(FBXW5) E3 ubiquitin-protein ligase complex during G2 phase, leading to its transient degradation and subsequent cell shape changes required to allow mitotic progression. Reappears at the midzone of dividing cells (By similarity).

Phosphorylation at Ser-625 and Thr-629 by MAPK following BDNF treatment promotes removal from actin and filopodia formation (By similarity). Phosphorylated by several receptor tyrosine kinases.

Subcellular Location:

Cytoplasm>Cell cortex. Cell projection>Ruffle membrane. Cell projection>Growth cone. Cell projection>Stereocilium. Cell junction>Synapse>Synaptosome.
Note: Localizes at the tips of the stereocilia of the inner and outer hair cells (By similarity). Localizes to the midzone of dividing cells.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in all tissues analyzed, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed in all epithelial and fibroblastic lines examined and in some, but not all, hematopoietic cells.

Subunit Structure:

Homodimer. Part of a complex consisting of ABI1, EPS8 and SOS1. Interacts with MYO15A and WHRN. Interacts with LANCL1 (By similarity). Interacts with EGFR; mediates EPS8 phosphorylation (By similarity). Interacts with BAIAP2. Interacts with SHB.

Family&Domains:

The effector region is required for activating the Rac-specific guanine nucleotide exchange factor (GEF) activity. It mediates both barbed-end actin capping and actin bundling activities. The capping activity is mediated by an amphipathic helix that binds within the hydrophobic pocket at the barbed ends of actin blocking further addition of actin monomers, while the bundling activity is mediated by a compact 4 helix bundle, which contacts 3 actin subunits along the filament (By similarity).

The SH3 domain mediates interaction with SHB.

Belongs to the EPS8 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.