OLIG1 Antibody - #DF8419
Product: | OLIG1 Antibody |
Catalog: | DF8419 |
Description: | Rabbit polyclonal antibody to OLIG1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Rabbit, Dog |
Mol.Wt.: | 35 kDa; 28kD(Calculated). |
Uniprot: | Q8TAK6 |
RRID: | AB_2841668 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8419, RRID:AB_2841668.
Fold/Unfold
Basic domain helix loop helix protein class B 6; Basic domain helix loop helix protein class B6; BHLH B6; BHLHB 6; bHLHb6; bHLHe21; Class B basic helix-loop-helix protein 6; Class E basic helix-loop-helix protein 21; Olig 1; Olig1; OLIG1_HUMAN; Oligo 1; Oligo1; Oligodendrocyte lineage transcription factor 1; Oligodendrocyte specific bHLH transcription factor 1; Oligodendrocyte transcription factor 1;
Immunogens
A synthesized peptide derived from human OLIG1, corresponding to a region within the internal amino acids.
Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable.
- Q8TAK6 OLIG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).
Nucleus.
Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.