CLPP Antibody - #DF8448
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8448, RRID:AB_2841688.
Fold/Unfold
ATP dependent protease ClpAP (E coli) proteolytic subunit; ATP dependent protease ClpAP proteolytic subunit; ATP dependent protease ClpAP proteolytic subunit human; ATP dependent proteolytic subunit homolog (E coli); ATP dependent proteolytic subunit homolog; Caseinolytic peptidase ATP dependent proteolytic subunit homolog; Caseinolytic protease ATP dependent proteolytic subunit E coli; clpP; ClpP caseinolytic peptidase ATP dependent proteolytic subunit; ClpP caseinolytic peptidase ATP dependent proteolytic subunit homolog; CLPP_HUMAN; Endopeptidase Clp; mitochondrial; Putative ATP dependent Clp protease proteolytic subunit mitochondrial; Putative ATP dependent Clp protease proteolytic subunit; Putative ATP-dependent Clp protease proteolytic subunit;
Immunogens
Detected in liver (at protein level). Predominantly expressed in skeletal muscle. Intermediate levels in heart, liver and pancreas. Low in brain, placenta, lung and kidney.
- Q16740 CLPP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q16740 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S169 | Phosphorylation | Uniprot | |
| S173 | Phosphorylation | Uniprot | |
| S181 | Phosphorylation | Uniprot | |
| T189 | Phosphorylation | Uniprot | |
| K203 | Ubiquitination | Uniprot | |
| K211 | Acetylation | Uniprot | |
| K211 | Ubiquitination | Uniprot | |
| K214 | Ubiquitination | Uniprot | |
| S231 | Phosphorylation | Uniprot | |
| T277 | Phosphorylation | Uniprot |
Research Backgrounds
Protease component of the Clp complex that cleaves peptides and various proteins in an ATP-dependent process. Has low peptidase activity in the absence of CLPX. The Clp complex can degrade CSN1S1, CSN2 and CSN3, as well as synthetic peptides (in vitro) and may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. Cleaves PINK1 in the mitochondrion.
Mitochondrion matrix.
Detected in liver (at protein level). Predominantly expressed in skeletal muscle. Intermediate levels in heart, liver and pancreas. Low in brain, placenta, lung and kidney.
Fourteen CLPP subunits assemble into 2 heptameric rings which stack back to back to give a disk-like structure with a central cavity. Component of the Clp complex formed by the assembly of two CLPP heptameric rings with two CLPX hexameric rings, giving rise to a symmetrical structure with two central CLPP rings flanked by a CLPX ring at either end of the complex.
Belongs to the peptidase S14 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.