CD24 Antibody - #DF8518
| Product: | CD24 Antibody |
| Catalog: | DF8518 |
| Description: | Rabbit polyclonal antibody to CD24 |
| Application: | WB IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Sheep |
| Mol.Wt.: | 8 kDa, 40~60kD; 8kD(Calculated). |
| Uniprot: | P25063 |
| RRID: | AB_2841723 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8518, RRID:AB_2841723.
Fold/Unfold
CD 24; CD24; CD24 antigen (small cell lung carcinoma cluster 4 antigen); CD24 antigen; CD24 molecule; CD24_HUMAN; CD24A; FLJ22950; FLJ43543; GPI linked surface mucin; Heat stable antigen; HSA; MGC75043; Nectadrin; Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen;
Immunogens
A synthesized peptide derived from human CD24, corresponding to a region within the internal amino acids.
B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.
- P25063 CD24_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90. Plays a role in the control of autoimmunity (By similarity).
Extensively O-glycosylated.
Cell membrane>Lipid-anchor.
B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.
Belongs to the CD24 family.
Research Fields
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
References
Application: WB Species: Mouse Sample: lung cancer tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.