Product: Involucrin Antibody
Catalog: AF0186
Description: Rabbit polyclonal antibody to Involucrin
Application: WB IHC IF/ICC
Cited expt.: IHC
Reactivity: Human, Mouse
Mol.Wt.: 68~120kDa; 68kD(Calculated).
Uniprot: P07476
RRID: AB_2833379

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
Involucrin Antibody detects endogenous levels of total Involucrin.
RRID:
AB_2833379
Cite Format: Affinity Biosciences Cat# AF0186, RRID:AB_2833379.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

INVO_HUMAN; Involucrin; IVL;

Immunogens

Immunogen:

A synthesized peptide derived from human Involucrin

Uniprot:
Gene(ID):
Expression:
P07476 INVO_HUMAN:

Keratinocytes of epidermis and other stratified squamous epithelia.

Description:
IVL Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia. Belongs to the involucrin family. Directly or indirectly cross-linked to cornifelin (CNFN).
Sequence:
MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK

Research Backgrounds

Function:

Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.

PTMs:

Substrate of transglutaminase. Some glutamines and lysines are cross-linked to other involucrin molecules, to other proteins such as keratin, desmoplakin, periplakin and envoplakin, and to lipids like omega-hydroxyceramide.

Subcellular Location:

Cytoplasm.
Note: Constituent of the scaffolding of the cornified envelope.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Keratinocytes of epidermis and other stratified squamous epithelia.

Family&Domains:

Belongs to the involucrin family.

References

1). The purinergic receptor P2rx7 mediated ATP sensing is required to prevent bone aging by directing mitochondrial fitness of MSCs. Journal of advanced research, 2025 (PubMed: 40518112) [IF=11.4]

2). Use of mouse primary epidermal organoids for USA300 infection modeling and drug screening. Research Square, 2022 (PubMed: 36631452) [IF=8.1]

Application: IHC    Species: Mouse    Sample: mPEOs

Fig. 1: Characterization of mouse primary epidermal organoids (mPEOs).A Overview of mPEOs formed from single cells within 7 d (scale bars, 100 μm). B Increased number of mPEOs observed within 7 d in bright field (scale bars, 100 μm). C H&E staining of mPEOs cultured for 7 d (scale bars, 50 μm). D Ultrathin sections in TEM images of mPEOs (scale bars, 20 μm), SB stratum basale, SP stratum spinosum, GR stratum granulosum, KG keratohyalin granules, SC stratum corneum. E Immunofluorescence staining analysis of various skin-associated specific biomarkers in mPEOs (scale bars, 200 μm). F Immunohistochemical staining of paraffin-embedded mPEOs. Representative images of Loricrin, KRT10, Involucrin, KRT14 and Ki67 immunoreactivity in organoids (scale bars, 50 μm).

3). GDU-952, a novel AhR agonist ameliorates skin barrier abnormalities and immune dysfunction in DNFB-induced atopic dermatitis in mice. Biochemical pharmacology, 2023 (PubMed: 37778446) [IF=5.3]

4). A multi-target combinatorial therapy of MDBA alleviates atopic dermatitis via synchronized immunosuppression and barrier repair. European journal of pharmacology, 2026 (PubMed: 41802486) [IF=4.2]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.