Defensin alpha3 Antibody - #DF8528
Product: | Defensin alpha3 Antibody |
Catalog: | DF8528 |
Description: | Rabbit polyclonal antibody to Defensin alpha3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 10 kDa; 10kD(Calculated). |
Uniprot: | P59666 |
RRID: | AB_2841732 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8528, RRID:AB_2841732.
Fold/Unfold
alpha 1; DEF1; DEF1_HUMAN; DEFA1; DEFA1B; DEFA2; Defensin 1; Defensin; Defensin, alpha 1; Defensin, alpha 1, myeloid related sequence; Defensin, alpha 2; HNP-1; HNP-2; HNP1; HP-1; HP-2; HP1; HP2; MRS; Myeloid related sequence; Neutrophil defensin 1; Neutrophil defensin 2;
Immunogens
A synthesized peptide derived from human Defensin alpha3, corresponding to a region within the internal amino acids.
- P59666 DEF3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Research Backgrounds
Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Secreted.
Belongs to the alpha-defensin family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.