Product: Defensin beta-1 Antibody
Catalog: DF8530
Description: Rabbit polyclonal antibody to Defensin beta-1
Application: WB
Reactivity: Human
Mol.Wt.: 7 kDa; 7kD(Calculated).
Uniprot: P60022
RRID: AB_2841734

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
Defensin beta-1 Antibody detects endogenous levels of total Defensin beta-1.
RRID:
AB_2841734
Cite Format: Affinity Biosciences Cat# DF8530, RRID:AB_2841734.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BD 1; BD-1; BD1; beta 1; Beta defensin 1; Beta-defensin 1; DEFB 1; DEFB1; DEFB1_HUMAN; DEFB101; Defensin; Defensin beta 1; Defensin beta 1 preproprotein; HBD 1; hBD-1; HBD1; MGC51822;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P60022 DEFB1_HUMAN:

Blood plasma. Sperm. Highly expressed in the lower head and midpiece of sperm. Significantly reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level).

Sequence:
MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Research Backgrounds

Function:

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

Subcellular Location:

Secreted. Membrane.
Note: Associates with tumor cell membrane-derived microvesicles (PubMed:23938203).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Blood plasma. Sperm. Highly expressed in the lower head and midpiece of sperm. Significantly reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level).

Subunit Structure:

Monomer. Homodimer.

Family&Domains:

Belongs to the beta-defensin family.

References

1). Gut microbiota and butyrate contribute to nonalcoholic fatty liver disease in premenopause due to estrogen deficiency. PLoS One, 2022 (PubMed: 35108315) [IF=2.9]

Application: WB    Species: Mouse    Sample:

Fig 6. Decreased production of Reg3γ and β-defensins in IEC of OH mice. IEC were isolated from the small intestines of C, SH and OH mice, respectively. A: IEC expression of Reg3γ and β-defensins 1 and 3 in OH and the control mice were determined by qRT-PCR. B: Protein levels of Reg3γ and β-defensins 1 were determined by western blot. C: Relative density ratio of Reg3γ and β-defensins 1. IEC, intestinal epithelial cell; qRT-PCR, quantitative real-time polymerase chain reaction; C, normal diet (n = 8); SH, sham+HFD (n = 10); OH, OVX+HFD (n = 8); OVX, ovariectomy; HFD, high fat diet.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.