Defensin beta-1 Antibody - #DF8530
| Product: | Defensin beta-1 Antibody |
| Catalog: | DF8530 |
| Description: | Rabbit polyclonal antibody to Defensin beta-1 |
| Application: | WB |
| Cited expt.: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 7 kDa; 7kD(Calculated). |
| Uniprot: | P60022 |
| RRID: | AB_2841734 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8530, RRID:AB_2841734.
Fold/Unfold
BD 1; BD-1; BD1; beta 1; Beta defensin 1; Beta-defensin 1; DEFB 1; DEFB1; DEFB1_HUMAN; DEFB101; Defensin; Defensin beta 1; Defensin beta 1 preproprotein; HBD 1; hBD-1; HBD1; MGC51822;
Immunogens
A synthesized peptide derived from human Defensin beta-1, corresponding to a region within the internal amino acids.
Blood plasma. Sperm. Highly expressed in the lower head and midpiece of sperm. Significantly reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level).
- P60022 DEFB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Research Backgrounds
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
Secreted. Membrane.
Note: Associates with tumor cell membrane-derived microvesicles (PubMed:23938203).
Blood plasma. Sperm. Highly expressed in the lower head and midpiece of sperm. Significantly reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level).
Belongs to the beta-defensin family.
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.