Defensin beta-2 Antibody - #DF8531
| Product: | Defensin beta-2 Antibody |
| Catalog: | DF8531 |
| Description: | Rabbit polyclonal antibody to Defensin beta-2 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 7 kDa; 7kD(Calculated). |
| Uniprot: | O15263 |
| RRID: | AB_2841735 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8531, RRID:AB_2841735.
Fold/Unfold
BD 2; BD-2; BD2; beta 2; Beta defensin 2; Beta defensin 4B; Beta-defensin 2; Beta-defensin 4A; DEF B2; DEF B4; DEFB 102; DEFB 2; DEFB 4; DEFB102; DEFB2; DEFB2, formerly; DEFB4; DEFB4, formerly; DEFB4B; DEFB4P; Defensin; Defensin beta 2; Defensin, beta 4; Defensin, beta 4, pseudogene; Defensin, beta 4A; Defensin, beta 4B; Defensin, beta, 2, formerly; Defensin, beta, 4, formerly; DFB4A_HUMAN; HBD 2; hBD-2; HBD2; mBD-2; SAP 1; SAP1; Skin antimicrobial peptide 1; Skin-antimicrobial peptide 1;
Immunogens
A synthesized peptide derived from human Defensin beta-2, corresponding to a region within the internal amino acids.
- O15263 DFB4A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Research Backgrounds
Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells.
Secreted.
Expressed in the skin and respiratory tract.
Belongs to the beta-defensin family. LAP/TAP subfamily.
Research Fields
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.