eIF5A2 Antibody - #DF8538
| Product: | eIF5A2 Antibody |
| Catalog: | DF8538 |
| Description: | Rabbit polyclonal antibody to eIF5A2 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 16 kDa; 17kD(Calculated). |
| Uniprot: | Q9GZV4 |
| RRID: | AB_2841742 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8538, RRID:AB_2841742.
Fold/Unfold
9630038B20; eIF 5A 2; eIF 5A2; eIF-4D; eIF-5A-2; eIF-5A2; EIF5A 2; EIF5A2; eIF5AII; Eukaryotic initiation factor 5A isoform 2; Eukaryotic translation initiation factor 5A-2; Eukaryotic translation initiation factor 5A2; IF5A2_HUMAN;
Immunogens
A synthesized peptide derived from human eIF5A2, corresponding to a region within the internal amino acids.
Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells.
- Q9GZV4 IF5A2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation (By similarity).
eIF-5A seems to be the only eukaryotic protein to have a hypusine residue which is a post-translational modification of a lysine by the addition of a butylamino group (from spermidine).
Cytoplasm. Nucleus. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side. Nucleus>Nuclear pore complex.
Note: Hypusine modification promotes the nuclear export and cytoplasmic localization and there was a dynamic shift in the localization from predominantly cytoplasmic to primarily nuclear under apoptotic inducing conditions.
Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells.
Belongs to the eIF-5A family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.